Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162NDP0

Protein Details
Accession A0A162NDP0   
Localization Confidence High
Confidence Score 18.5
NoLS Segment(s)
PositionSequenceProtein Nature
10-35AQSSSGEQKSRRRTKQKNERIPMTLRHydrophilic
80-104KLPELERKRKPLQKKQYMVKINLRRHydrophilic
NLS Segment(s)
PositionSequence
21-22RR
Subcellular Location(s) nucl 22, mito 4
Family & Domain DBs
Amino Acid Sequences MNPTSQSISAQSSSGEQKSRRRTKQKNERIPMTLRKRIFNLTLPLALTVSLDIKQVWNAKPFHLKYSFIVSRRNSDSVLKLPELERKRKPLQKKQYMVKINLRRQSTGMAYNLRLVLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.29
3 0.3
4 0.38
5 0.49
6 0.59
7 0.65
8 0.72
9 0.79
10 0.84
11 0.9
12 0.92
13 0.92
14 0.91
15 0.86
16 0.8
17 0.77
18 0.76
19 0.73
20 0.7
21 0.61
22 0.55
23 0.52
24 0.5
25 0.46
26 0.41
27 0.36
28 0.31
29 0.3
30 0.27
31 0.24
32 0.21
33 0.17
34 0.12
35 0.08
36 0.07
37 0.06
38 0.06
39 0.06
40 0.06
41 0.09
42 0.13
43 0.14
44 0.18
45 0.19
46 0.2
47 0.28
48 0.29
49 0.31
50 0.29
51 0.29
52 0.25
53 0.33
54 0.36
55 0.3
56 0.36
57 0.32
58 0.35
59 0.38
60 0.38
61 0.31
62 0.29
63 0.3
64 0.28
65 0.3
66 0.25
67 0.23
68 0.23
69 0.3
70 0.34
71 0.38
72 0.39
73 0.44
74 0.53
75 0.59
76 0.69
77 0.71
78 0.76
79 0.79
80 0.83
81 0.84
82 0.85
83 0.85
84 0.81
85 0.8
86 0.79
87 0.77
88 0.75
89 0.69
90 0.61
91 0.55
92 0.53
93 0.47
94 0.42
95 0.38
96 0.36
97 0.34
98 0.36