Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I2H6R5

Protein Details
Accession I2H6R5    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
59-81DENIHFFKKDRRNSINKNRNANEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, mito 10, cyto_nucl 8, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006861  HABP4_PAIRBP1-bd  
KEGG tbl:TBLA_0G01190  -  
Pfam View protein in Pfam  
PF04774  HABP4_PAI-RBP1  
Amino Acid Sequences MTRTNKWTVHEKKANARFFTRNGNLGQDPNSIKKSGNGKGNWGKPGDEINDLMDSGELDENIHFFKKDRRNSINKNRNANEDDLRKIQNHED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.69
3 0.66
4 0.6
5 0.55
6 0.59
7 0.52
8 0.46
9 0.4
10 0.41
11 0.37
12 0.34
13 0.33
14 0.28
15 0.27
16 0.27
17 0.28
18 0.24
19 0.22
20 0.26
21 0.3
22 0.31
23 0.36
24 0.32
25 0.38
26 0.45
27 0.48
28 0.46
29 0.4
30 0.35
31 0.29
32 0.31
33 0.25
34 0.19
35 0.15
36 0.13
37 0.13
38 0.12
39 0.11
40 0.08
41 0.06
42 0.06
43 0.06
44 0.05
45 0.05
46 0.05
47 0.06
48 0.07
49 0.08
50 0.07
51 0.08
52 0.17
53 0.26
54 0.34
55 0.43
56 0.51
57 0.6
58 0.71
59 0.81
60 0.82
61 0.81
62 0.83
63 0.77
64 0.76
65 0.7
66 0.64
67 0.61
68 0.56
69 0.54
70 0.49
71 0.48
72 0.43