Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162ZZB3

Protein Details
Accession A0A162ZZB3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
15-35RIGGKGTPRRKTKKVVKVSSSHydrophilic
NLS Segment(s)
PositionSequence
18-28GKGTPRRKTKK
Subcellular Location(s) mito 17.5, mito_nucl 9.833, cyto 8.5, cyto_nucl 5.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR039370  BTF3  
IPR038187  NAC_A/B_dom_sf  
IPR002715  Nas_poly-pep-assoc_cplx_dom  
Gene Ontology GO:0005737  C:cytoplasm  
Pfam View protein in Pfam  
PF01849  NAC  
PROSITE View protein in PROSITE  
PS51151  NAC_AB  
CDD cd22055  NAC_BTF3  
Amino Acid Sequences IMNADKLAKLQAQVRIGGKGTPRRKTKKVVKVSSSGDDRKLSAALTKLGVQPIAGVEEVNMFRDDGKVIHFGAPKVQAAANCNTFAIHGRAAEKDLAELVPGILSQMGPDSLASLRKLAEAYQAQQGAPAGEDDDEIPDLVESFDKAEIEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.31
4 0.31
5 0.33
6 0.37
7 0.43
8 0.47
9 0.56
10 0.61
11 0.67
12 0.74
13 0.78
14 0.79
15 0.81
16 0.82
17 0.77
18 0.76
19 0.74
20 0.71
21 0.67
22 0.59
23 0.52
24 0.44
25 0.39
26 0.33
27 0.29
28 0.22
29 0.17
30 0.16
31 0.14
32 0.14
33 0.15
34 0.16
35 0.16
36 0.15
37 0.12
38 0.11
39 0.1
40 0.1
41 0.07
42 0.06
43 0.05
44 0.08
45 0.08
46 0.09
47 0.09
48 0.08
49 0.08
50 0.08
51 0.09
52 0.06
53 0.08
54 0.08
55 0.09
56 0.12
57 0.13
58 0.13
59 0.15
60 0.16
61 0.15
62 0.14
63 0.15
64 0.12
65 0.13
66 0.16
67 0.15
68 0.14
69 0.14
70 0.13
71 0.12
72 0.13
73 0.12
74 0.1
75 0.09
76 0.1
77 0.11
78 0.12
79 0.13
80 0.11
81 0.09
82 0.09
83 0.08
84 0.07
85 0.07
86 0.05
87 0.04
88 0.04
89 0.04
90 0.04
91 0.04
92 0.03
93 0.04
94 0.04
95 0.04
96 0.04
97 0.06
98 0.07
99 0.1
100 0.1
101 0.11
102 0.11
103 0.12
104 0.12
105 0.11
106 0.17
107 0.18
108 0.19
109 0.24
110 0.25
111 0.24
112 0.25
113 0.25
114 0.18
115 0.16
116 0.14
117 0.08
118 0.08
119 0.08
120 0.08
121 0.09
122 0.09
123 0.09
124 0.09
125 0.08
126 0.08
127 0.08
128 0.08
129 0.07
130 0.08
131 0.09