Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167L0J8

Protein Details
Accession A0A167L0J8    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
99-122NSAPSKHHNQSQQRQQQNNRSQSGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, cyto_nucl 10, cyto 7, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR035912  EHR_sf  
IPR000781  ERH  
Pfam View protein in Pfam  
PF01133  ER  
Amino Acid Sequences MSFHTILLVQPTNGANRTYSDFETIAATLDHVASLFEQKLQRENPRSGQIQYRAEDLFRFIDSYKEFVALVFDQTTQAYLPRDKEWIKDRLLAHFSQQNSAPSKHHNQSQQRQQQNNRSQSGRRW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.17
3 0.18
4 0.23
5 0.24
6 0.24
7 0.24
8 0.22
9 0.22
10 0.22
11 0.2
12 0.16
13 0.12
14 0.11
15 0.08
16 0.08
17 0.07
18 0.05
19 0.05
20 0.05
21 0.07
22 0.07
23 0.11
24 0.13
25 0.14
26 0.19
27 0.24
28 0.31
29 0.35
30 0.38
31 0.39
32 0.43
33 0.44
34 0.41
35 0.43
36 0.41
37 0.4
38 0.37
39 0.35
40 0.3
41 0.28
42 0.26
43 0.21
44 0.15
45 0.11
46 0.11
47 0.09
48 0.11
49 0.11
50 0.13
51 0.11
52 0.11
53 0.1
54 0.09
55 0.12
56 0.09
57 0.09
58 0.08
59 0.08
60 0.08
61 0.08
62 0.09
63 0.06
64 0.08
65 0.09
66 0.11
67 0.13
68 0.14
69 0.19
70 0.2
71 0.25
72 0.29
73 0.32
74 0.33
75 0.36
76 0.36
77 0.38
78 0.41
79 0.36
80 0.34
81 0.33
82 0.31
83 0.28
84 0.3
85 0.28
86 0.29
87 0.3
88 0.29
89 0.31
90 0.39
91 0.41
92 0.45
93 0.5
94 0.56
95 0.64
96 0.73
97 0.76
98 0.77
99 0.81
100 0.84
101 0.86
102 0.86
103 0.84
104 0.79
105 0.75