Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A163AII3

Protein Details
Accession A0A163AII3    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
29-48VPKPLLPKAHKKKRLAFVRTHydrophilic
NLS Segment(s)
PositionSequence
36-42KAHKKKR
Subcellular Location(s) nucl 15, mito 9, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MSIILEHSISKSTICRTSYKDEMSSCRVVPKPLLPKAHKKKRLAFVRTATEFIYQEDNAPSHRSNLEEEWKRRQNLAMIVCPPNSPVISPLENLWTHLARKDNIQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.28
3 0.32
4 0.39
5 0.44
6 0.45
7 0.45
8 0.42
9 0.45
10 0.47
11 0.44
12 0.38
13 0.37
14 0.35
15 0.32
16 0.31
17 0.33
18 0.36
19 0.4
20 0.48
21 0.46
22 0.56
23 0.65
24 0.74
25 0.74
26 0.72
27 0.75
28 0.76
29 0.81
30 0.75
31 0.71
32 0.65
33 0.64
34 0.59
35 0.52
36 0.42
37 0.34
38 0.29
39 0.23
40 0.2
41 0.13
42 0.13
43 0.12
44 0.12
45 0.11
46 0.13
47 0.13
48 0.12
49 0.13
50 0.13
51 0.15
52 0.18
53 0.26
54 0.32
55 0.35
56 0.43
57 0.49
58 0.49
59 0.47
60 0.46
61 0.41
62 0.4
63 0.41
64 0.37
65 0.35
66 0.36
67 0.36
68 0.34
69 0.3
70 0.25
71 0.21
72 0.16
73 0.14
74 0.16
75 0.17
76 0.18
77 0.18
78 0.21
79 0.21
80 0.22
81 0.25
82 0.22
83 0.22
84 0.26
85 0.3
86 0.25