Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162WWR1

Protein Details
Accession A0A162WWR1   
Localization Confidence Low
Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
55-77KRDGEYKLKCTRRKRKAAPDIIVBasic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 14.833, nucl 14, cyto 10.5, mito_nucl 9.165
Family & Domain DBs
InterPro View protein in InterPro  
IPR028375  KA1/Ssp2_C  
IPR001772  KA1_dom  
Gene Ontology GO:0005524  F:ATP binding  
GO:0004674  F:protein serine/threonine kinase activity  
Pfam View protein in Pfam  
PF02149  KA1  
PROSITE View protein in PROSITE  
PS50032  KA1  
Amino Acid Sequences MHIGKALGSYAVDFNDSKLRTHHGAVDQDALTSRPPHEVFVQVKQALGSMGIDVKRDGEYKLKCTRRKRKAAPDIIVTGSQVSGVSETTETVYGDPVVDSGEEVRFSVELCKIKNLPGLYIVDIRRMKGSVWAYKCIYHALLETLDLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.2
3 0.21
4 0.2
5 0.21
6 0.26
7 0.27
8 0.28
9 0.32
10 0.31
11 0.34
12 0.34
13 0.37
14 0.31
15 0.28
16 0.27
17 0.22
18 0.18
19 0.16
20 0.15
21 0.16
22 0.17
23 0.18
24 0.19
25 0.26
26 0.27
27 0.3
28 0.36
29 0.3
30 0.3
31 0.28
32 0.26
33 0.19
34 0.16
35 0.11
36 0.05
37 0.08
38 0.08
39 0.09
40 0.08
41 0.09
42 0.1
43 0.11
44 0.12
45 0.16
46 0.18
47 0.23
48 0.33
49 0.4
50 0.46
51 0.56
52 0.66
53 0.69
54 0.78
55 0.81
56 0.83
57 0.85
58 0.86
59 0.79
60 0.71
61 0.63
62 0.54
63 0.45
64 0.33
65 0.23
66 0.14
67 0.11
68 0.07
69 0.05
70 0.04
71 0.04
72 0.04
73 0.04
74 0.05
75 0.05
76 0.06
77 0.06
78 0.06
79 0.07
80 0.06
81 0.06
82 0.06
83 0.05
84 0.05
85 0.05
86 0.05
87 0.05
88 0.06
89 0.06
90 0.06
91 0.07
92 0.06
93 0.07
94 0.09
95 0.13
96 0.16
97 0.17
98 0.22
99 0.22
100 0.24
101 0.29
102 0.27
103 0.23
104 0.23
105 0.24
106 0.22
107 0.27
108 0.25
109 0.29
110 0.29
111 0.29
112 0.28
113 0.26
114 0.24
115 0.26
116 0.32
117 0.33
118 0.35
119 0.4
120 0.4
121 0.42
122 0.43
123 0.38
124 0.33
125 0.25
126 0.23
127 0.2
128 0.19