Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167R867

Protein Details
Accession A0A167R867   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
55-84EREQRQQKAQEQPQKRRRFAKRVPAVQGLKHydrophilic
NLS Segment(s)
PositionSequence
69-76KRRRFAKR
Subcellular Location(s) golg 7, E.R. 6, mito 3, extr 3, nucl 2, cyto 2, plas 2, cyto_nucl 2, vacu 2
Family & Domain DBs
Amino Acid Sequences MKFYLFLLSVLLLTIFGTQVCIAEDPALLEGQGTIADDIKKFESRPSLIDRLALEREQRQQKAQEQPQKRRRFAKRVPAVQGLKRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.05
4 0.06
5 0.05
6 0.06
7 0.07
8 0.07
9 0.07
10 0.07
11 0.07
12 0.07
13 0.08
14 0.07
15 0.06
16 0.05
17 0.05
18 0.04
19 0.04
20 0.04
21 0.04
22 0.05
23 0.06
24 0.06
25 0.08
26 0.09
27 0.11
28 0.11
29 0.12
30 0.15
31 0.16
32 0.19
33 0.23
34 0.25
35 0.24
36 0.26
37 0.24
38 0.24
39 0.25
40 0.23
41 0.19
42 0.19
43 0.27
44 0.33
45 0.34
46 0.34
47 0.38
48 0.44
49 0.52
50 0.58
51 0.6
52 0.63
53 0.72
54 0.78
55 0.83
56 0.83
57 0.82
58 0.83
59 0.84
60 0.84
61 0.84
62 0.84
63 0.83
64 0.83
65 0.82
66 0.79