Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162TV44

Protein Details
Accession A0A162TV44    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
173-200QHIGNRKLQEKKQEKRSRKRIDESVFISHydrophilic
NLS Segment(s)
PositionSequence
182-192EKKQEKRSRKR
Subcellular Location(s) nucl 25, cyto_nucl 15.5
Family & Domain DBs
Amino Acid Sequences MSRNLNNNSVNNAFGEEPSVGSPPRNTNDIRTIMLQHSQRTVSNQRPLAPKRARLNLEGDSSGRTCNIHDVYEKLDTMNSVLNTVLKNTSSEKAEATASNAVEQDMSPECQPTLDQLLRYYLSEEKLYDQYNTNKNKNSEGNRLILKSITKYLCHQEEGKKMNLPTFRTNIVQHIGNRKLQEKKQEKRSRKRIDESVFISNIRVKEDNLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.13
4 0.13
5 0.13
6 0.15
7 0.13
8 0.14
9 0.18
10 0.22
11 0.25
12 0.28
13 0.28
14 0.32
15 0.39
16 0.4
17 0.39
18 0.34
19 0.34
20 0.32
21 0.37
22 0.34
23 0.29
24 0.29
25 0.29
26 0.28
27 0.31
28 0.37
29 0.38
30 0.43
31 0.44
32 0.46
33 0.54
34 0.56
35 0.6
36 0.58
37 0.59
38 0.58
39 0.63
40 0.61
41 0.54
42 0.55
43 0.49
44 0.46
45 0.39
46 0.32
47 0.26
48 0.24
49 0.22
50 0.17
51 0.13
52 0.11
53 0.15
54 0.16
55 0.15
56 0.15
57 0.16
58 0.19
59 0.2
60 0.2
61 0.15
62 0.13
63 0.12
64 0.12
65 0.14
66 0.11
67 0.09
68 0.09
69 0.1
70 0.1
71 0.11
72 0.11
73 0.08
74 0.09
75 0.11
76 0.14
77 0.14
78 0.14
79 0.13
80 0.14
81 0.15
82 0.13
83 0.13
84 0.14
85 0.12
86 0.12
87 0.12
88 0.11
89 0.1
90 0.09
91 0.09
92 0.07
93 0.08
94 0.07
95 0.08
96 0.07
97 0.07
98 0.08
99 0.07
100 0.12
101 0.12
102 0.12
103 0.13
104 0.15
105 0.15
106 0.15
107 0.16
108 0.12
109 0.13
110 0.13
111 0.13
112 0.14
113 0.16
114 0.17
115 0.16
116 0.18
117 0.24
118 0.31
119 0.37
120 0.39
121 0.41
122 0.42
123 0.46
124 0.5
125 0.49
126 0.5
127 0.46
128 0.46
129 0.43
130 0.43
131 0.38
132 0.32
133 0.28
134 0.21
135 0.25
136 0.22
137 0.21
138 0.24
139 0.3
140 0.31
141 0.32
142 0.35
143 0.35
144 0.41
145 0.44
146 0.44
147 0.42
148 0.4
149 0.42
150 0.43
151 0.41
152 0.38
153 0.38
154 0.37
155 0.36
156 0.37
157 0.35
158 0.34
159 0.33
160 0.32
161 0.38
162 0.39
163 0.39
164 0.41
165 0.44
166 0.49
167 0.5
168 0.56
169 0.58
170 0.63
171 0.71
172 0.78
173 0.82
174 0.85
175 0.91
176 0.92
177 0.91
178 0.9
179 0.89
180 0.85
181 0.83
182 0.77
183 0.73
184 0.63
185 0.54
186 0.47
187 0.42
188 0.36
189 0.32
190 0.29