Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162UUW4

Protein Details
Accession A0A162UUW4   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
91-113LMIREKREKIGKRCSHRGNLNFNHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 9, mito 7, E.R. 6, golg 2, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MARDTLPGPSSGVGKVASHLDCLSESMMVVMMMMIMMMLLLVMSGVDVDVDVVILILIFLLILILILIVILILILILILILIVLVKMTKILMIREKREKIGKRCSHRGNLNFNVAIMPES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.17
4 0.16
5 0.16
6 0.16
7 0.15
8 0.14
9 0.15
10 0.14
11 0.09
12 0.09
13 0.07
14 0.07
15 0.06
16 0.05
17 0.04
18 0.03
19 0.03
20 0.03
21 0.02
22 0.02
23 0.02
24 0.01
25 0.01
26 0.01
27 0.01
28 0.01
29 0.01
30 0.01
31 0.01
32 0.01
33 0.02
34 0.02
35 0.02
36 0.02
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.02
43 0.02
44 0.01
45 0.01
46 0.01
47 0.01
48 0.01
49 0.01
50 0.01
51 0.01
52 0.01
53 0.01
54 0.01
55 0.01
56 0.01
57 0.01
58 0.01
59 0.01
60 0.01
61 0.01
62 0.01
63 0.01
64 0.01
65 0.01
66 0.01
67 0.01
68 0.01
69 0.01
70 0.02
71 0.02
72 0.02
73 0.02
74 0.03
75 0.05
76 0.06
77 0.09
78 0.18
79 0.25
80 0.32
81 0.41
82 0.44
83 0.48
84 0.57
85 0.63
86 0.63
87 0.68
88 0.7
89 0.7
90 0.77
91 0.8
92 0.8
93 0.81
94 0.8
95 0.79
96 0.76
97 0.73
98 0.64
99 0.56
100 0.47