Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2H2R4

Protein Details
Accession I2H2R4    Localization Confidence Low Confidence Score 5.6
NoLS Segment(s)
PositionSequenceProtein Nature
49-68FTEAKKRKFIPQKPLNFSRNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 2, cyto 2, cyto_nucl 2, pero 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR038584  L33_sf  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0006412  P:translation  
KEGG tbl:TBLA_0D01580  -  
Amino Acid Sequences MAKDKAKTSVVKLLSTAATGFSRYIRVKRGAPLVTQVRYDPIAQRHVVFTEAKKRKFIPQKPLNFSRNPKQT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.25
3 0.21
4 0.14
5 0.12
6 0.12
7 0.12
8 0.1
9 0.16
10 0.17
11 0.2
12 0.23
13 0.26
14 0.27
15 0.31
16 0.37
17 0.33
18 0.31
19 0.35
20 0.34
21 0.32
22 0.3
23 0.26
24 0.21
25 0.21
26 0.21
27 0.18
28 0.16
29 0.19
30 0.19
31 0.2
32 0.19
33 0.19
34 0.2
35 0.18
36 0.18
37 0.26
38 0.33
39 0.35
40 0.38
41 0.39
42 0.47
43 0.56
44 0.61
45 0.61
46 0.63
47 0.72
48 0.76
49 0.83
50 0.79
51 0.77
52 0.77