Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167PF20

Protein Details
Accession A0A167PF20    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
83-115LTSVLRKRRLKMNKHKHKKLLKRTRALRKRLGKBasic
NLS Segment(s)
PositionSequence
88-115RKRRLKMNKHKHKKLLKRTRALRKRLGK
Subcellular Location(s) mito 22, mito_nucl 13.333, cyto_mito 11.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR013177  COX24_C  
Pfam View protein in Pfam  
PF08213  COX24_C  
Amino Acid Sequences MLARFASRAASLAMGGLTTPFQRPIGNVIATRLASTSSTVNTASFGFLPLGTSVPKMSLLSEQLSRLRPFSPPPAPVVETFELTSVLRKRRLKMNKHKHKKLLKRTRALRKRLGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.06
4 0.06
5 0.07
6 0.08
7 0.09
8 0.1
9 0.11
10 0.12
11 0.16
12 0.2
13 0.21
14 0.2
15 0.2
16 0.23
17 0.22
18 0.21
19 0.17
20 0.13
21 0.11
22 0.12
23 0.11
24 0.09
25 0.1
26 0.1
27 0.1
28 0.1
29 0.1
30 0.1
31 0.08
32 0.08
33 0.07
34 0.07
35 0.07
36 0.07
37 0.07
38 0.07
39 0.07
40 0.06
41 0.06
42 0.07
43 0.06
44 0.07
45 0.07
46 0.09
47 0.1
48 0.11
49 0.12
50 0.15
51 0.18
52 0.18
53 0.18
54 0.17
55 0.17
56 0.19
57 0.24
58 0.26
59 0.24
60 0.26
61 0.29
62 0.29
63 0.29
64 0.32
65 0.26
66 0.22
67 0.21
68 0.19
69 0.16
70 0.15
71 0.2
72 0.19
73 0.23
74 0.3
75 0.34
76 0.38
77 0.47
78 0.57
79 0.62
80 0.69
81 0.75
82 0.78
83 0.86
84 0.92
85 0.92
86 0.93
87 0.92
88 0.92
89 0.92
90 0.91
91 0.91
92 0.91
93 0.93
94 0.92
95 0.89