Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167QWB3

Protein Details
Accession A0A167QWB3   
Localization Confidence Low
Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
40-75FIHKHNYKYKYKYKYKHKYSCKCKCKRKCTFITLMFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 9, cyto_nucl 7.5, mito 5, cyto 4, plas 4, pero 3
Family & Domain DBs
Amino Acid Sequences MAHKPFTDASDCLSGGFYYTQRIPTVRPHCVMMGLPKFFFIHKHNYKYKYKYKYKHKYSCKCKCKRKCTFITLMFNKINTLMSLLLGFGLNKPKQPPIADISVHPIQFCLVIIITIHRPKIRQVLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.16
3 0.17
4 0.14
5 0.14
6 0.16
7 0.18
8 0.19
9 0.2
10 0.21
11 0.29
12 0.36
13 0.37
14 0.36
15 0.36
16 0.35
17 0.35
18 0.34
19 0.32
20 0.31
21 0.27
22 0.26
23 0.25
24 0.25
25 0.23
26 0.26
27 0.21
28 0.26
29 0.31
30 0.39
31 0.45
32 0.51
33 0.59
34 0.63
35 0.69
36 0.69
37 0.71
38 0.73
39 0.77
40 0.81
41 0.84
42 0.86
43 0.88
44 0.88
45 0.89
46 0.91
47 0.9
48 0.89
49 0.89
50 0.89
51 0.9
52 0.89
53 0.88
54 0.85
55 0.81
56 0.8
57 0.77
58 0.76
59 0.68
60 0.64
61 0.55
62 0.47
63 0.4
64 0.32
65 0.25
66 0.15
67 0.14
68 0.08
69 0.07
70 0.07
71 0.07
72 0.06
73 0.06
74 0.06
75 0.06
76 0.14
77 0.14
78 0.17
79 0.19
80 0.22
81 0.26
82 0.28
83 0.3
84 0.27
85 0.32
86 0.3
87 0.29
88 0.33
89 0.33
90 0.31
91 0.27
92 0.23
93 0.18
94 0.17
95 0.16
96 0.11
97 0.07
98 0.07
99 0.08
100 0.11
101 0.17
102 0.21
103 0.25
104 0.25
105 0.27
106 0.31