Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162YI30

Protein Details
Accession A0A162YI30   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
5-30SDGWIAKLKKRLRVKSRKMHGKSFSAHydrophilic
NLS Segment(s)
PositionSequence
11-30KLKKRLRVKSRKMHGKSFSA
Subcellular Location(s) mito 19, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR004875  DDE_SF_endonuclease_dom  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF03184  DDE_1  
Amino Acid Sequences MLSFSDGWIAKLKKRLRVKSRKMHGKSFSAPKDTKEINLRVEEIKKKLRMYERKDIFNFDETGLFYKQPLVSTISTAAISGQKTDKVRLTVALICNSDGFWKLKPFIIDKYAKPRCFGKKNGKLLHYLYYYNNDKSWMTGTIFKDICKIIDC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.64
3 0.67
4 0.76
5 0.82
6 0.85
7 0.9
8 0.92
9 0.88
10 0.87
11 0.82
12 0.78
13 0.75
14 0.74
15 0.69
16 0.66
17 0.61
18 0.54
19 0.55
20 0.48
21 0.46
22 0.43
23 0.41
24 0.37
25 0.38
26 0.38
27 0.35
28 0.4
29 0.4
30 0.38
31 0.41
32 0.41
33 0.4
34 0.44
35 0.5
36 0.54
37 0.56
38 0.62
39 0.6
40 0.63
41 0.63
42 0.61
43 0.53
44 0.46
45 0.4
46 0.29
47 0.25
48 0.18
49 0.2
50 0.17
51 0.14
52 0.11
53 0.12
54 0.12
55 0.11
56 0.12
57 0.13
58 0.12
59 0.13
60 0.14
61 0.12
62 0.11
63 0.11
64 0.1
65 0.09
66 0.09
67 0.09
68 0.09
69 0.12
70 0.13
71 0.15
72 0.17
73 0.16
74 0.17
75 0.17
76 0.19
77 0.19
78 0.21
79 0.22
80 0.2
81 0.18
82 0.18
83 0.17
84 0.15
85 0.13
86 0.12
87 0.11
88 0.13
89 0.14
90 0.16
91 0.19
92 0.2
93 0.22
94 0.28
95 0.31
96 0.32
97 0.41
98 0.48
99 0.47
100 0.47
101 0.51
102 0.54
103 0.57
104 0.62
105 0.63
106 0.64
107 0.73
108 0.78
109 0.72
110 0.68
111 0.63
112 0.61
113 0.52
114 0.45
115 0.37
116 0.37
117 0.4
118 0.37
119 0.35
120 0.3
121 0.27
122 0.27
123 0.27
124 0.23
125 0.21
126 0.26
127 0.27
128 0.33
129 0.34
130 0.33
131 0.34
132 0.31