Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167RB76

Protein Details
Accession A0A167RB76    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MSSRNKRTRSPSKRCELSEFHydrophilic
58-79ETGTTKPKTRPGRPKKLSVTDVHydrophilic
252-273PYNIRNRSGQRQGQRKQREKYRHydrophilic
NLS Segment(s)
PositionSequence
65-72KTRPGRPK
Subcellular Location(s) mito 16.5, nucl 9.5, cyto_mito 9.333, cyto_nucl 5.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR036397  RNaseH_sf  
IPR038717  Tc1-like_DDE_dom  
IPR036388  WH-like_DNA-bd_sf  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF13358  DDE_3  
Amino Acid Sequences MSSRNKRTRSPSKRCELSEFEHGGIIWLYKTKNTPTEIANHIGIPRATINITIKRWEETGTTKPKTRPGRPKKLSVTDVTSLCLSVRCNPFESYAYHQRNMAAAGVIICRDTVIQYLKAKGFGSYTPVSKSNLICEQKKNRLCWVKARASFGIEDWSRVWKNRWEIKCFDYWPSQSPDLNPIERVWHALKANVEELKACILQKWERLDPGLLCTLVASMLDRVQAVIKACVYLRLEIKESDCYLFGTSVDLPYNIRNRSGQRQGQRKQREKYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.8
3 0.75
4 0.69
5 0.68
6 0.61
7 0.51
8 0.43
9 0.39
10 0.32
11 0.26
12 0.21
13 0.13
14 0.13
15 0.13
16 0.14
17 0.18
18 0.22
19 0.27
20 0.3
21 0.32
22 0.31
23 0.37
24 0.38
25 0.38
26 0.34
27 0.3
28 0.27
29 0.27
30 0.25
31 0.2
32 0.17
33 0.15
34 0.14
35 0.16
36 0.21
37 0.25
38 0.26
39 0.29
40 0.29
41 0.3
42 0.3
43 0.28
44 0.26
45 0.24
46 0.32
47 0.37
48 0.4
49 0.44
50 0.46
51 0.54
52 0.6
53 0.65
54 0.67
55 0.69
56 0.76
57 0.76
58 0.83
59 0.83
60 0.81
61 0.75
62 0.68
63 0.63
64 0.56
65 0.51
66 0.43
67 0.34
68 0.26
69 0.21
70 0.19
71 0.14
72 0.16
73 0.2
74 0.2
75 0.23
76 0.24
77 0.26
78 0.26
79 0.28
80 0.28
81 0.35
82 0.37
83 0.35
84 0.35
85 0.33
86 0.32
87 0.29
88 0.22
89 0.12
90 0.08
91 0.08
92 0.08
93 0.07
94 0.06
95 0.05
96 0.05
97 0.05
98 0.05
99 0.07
100 0.08
101 0.12
102 0.13
103 0.17
104 0.17
105 0.19
106 0.19
107 0.17
108 0.16
109 0.12
110 0.16
111 0.15
112 0.16
113 0.16
114 0.18
115 0.19
116 0.2
117 0.2
118 0.18
119 0.24
120 0.27
121 0.28
122 0.34
123 0.39
124 0.46
125 0.5
126 0.48
127 0.49
128 0.53
129 0.51
130 0.53
131 0.54
132 0.54
133 0.53
134 0.55
135 0.47
136 0.41
137 0.39
138 0.31
139 0.29
140 0.2
141 0.19
142 0.15
143 0.19
144 0.19
145 0.2
146 0.22
147 0.21
148 0.3
149 0.37
150 0.42
151 0.41
152 0.44
153 0.45
154 0.48
155 0.45
156 0.4
157 0.37
158 0.34
159 0.33
160 0.35
161 0.34
162 0.3
163 0.29
164 0.32
165 0.3
166 0.29
167 0.26
168 0.21
169 0.21
170 0.21
171 0.24
172 0.19
173 0.2
174 0.19
175 0.21
176 0.22
177 0.21
178 0.25
179 0.22
180 0.21
181 0.17
182 0.17
183 0.17
184 0.16
185 0.14
186 0.12
187 0.15
188 0.18
189 0.23
190 0.28
191 0.28
192 0.28
193 0.3
194 0.31
195 0.27
196 0.28
197 0.25
198 0.19
199 0.16
200 0.15
201 0.13
202 0.11
203 0.1
204 0.07
205 0.06
206 0.07
207 0.08
208 0.07
209 0.08
210 0.09
211 0.11
212 0.12
213 0.13
214 0.13
215 0.14
216 0.14
217 0.18
218 0.19
219 0.2
220 0.23
221 0.24
222 0.26
223 0.27
224 0.29
225 0.29
226 0.29
227 0.27
228 0.24
229 0.21
230 0.21
231 0.19
232 0.17
233 0.15
234 0.14
235 0.15
236 0.16
237 0.15
238 0.15
239 0.21
240 0.28
241 0.26
242 0.28
243 0.31
244 0.37
245 0.46
246 0.54
247 0.57
248 0.6
249 0.69
250 0.75
251 0.8
252 0.85
253 0.85