Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167Q5Y9

Protein Details
Accession A0A167Q5Y9   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
103-124VLKAQRSRKRLDPSRRVGRKIVHydrophilic
NLS Segment(s)
PositionSequence
107-119QRSRKRLDPSRRV
Subcellular Location(s) cyto 18, cyto_nucl 11.5, cysk 4, nucl 3
Family & Domain DBs
Amino Acid Sequences MDGSEVMHRLWNRDLAAVLNFRHILNNLRYDGTIPVRFTRVIRIGRIRRQAEDLQEGRRPTQATADCESQLIEFAKGVFLITDSRSETAYERKELATKNGAHVLKAQRSRKRLDPSRRVGRKIVYIALKILAATNVCLEGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.21
3 0.24
4 0.24
5 0.22
6 0.21
7 0.21
8 0.2
9 0.21
10 0.21
11 0.23
12 0.24
13 0.28
14 0.26
15 0.26
16 0.26
17 0.25
18 0.28
19 0.28
20 0.27
21 0.23
22 0.24
23 0.24
24 0.26
25 0.25
26 0.28
27 0.29
28 0.28
29 0.32
30 0.4
31 0.45
32 0.52
33 0.6
34 0.55
35 0.5
36 0.53
37 0.51
38 0.45
39 0.45
40 0.4
41 0.34
42 0.36
43 0.35
44 0.3
45 0.3
46 0.27
47 0.19
48 0.24
49 0.24
50 0.25
51 0.27
52 0.28
53 0.25
54 0.25
55 0.24
56 0.17
57 0.15
58 0.11
59 0.08
60 0.06
61 0.06
62 0.06
63 0.06
64 0.06
65 0.04
66 0.04
67 0.05
68 0.06
69 0.07
70 0.08
71 0.09
72 0.1
73 0.11
74 0.12
75 0.17
76 0.19
77 0.19
78 0.2
79 0.2
80 0.24
81 0.24
82 0.27
83 0.27
84 0.26
85 0.27
86 0.33
87 0.32
88 0.29
89 0.34
90 0.36
91 0.37
92 0.44
93 0.5
94 0.5
95 0.54
96 0.59
97 0.62
98 0.66
99 0.69
100 0.71
101 0.73
102 0.76
103 0.83
104 0.85
105 0.81
106 0.75
107 0.7
108 0.66
109 0.59
110 0.56
111 0.5
112 0.43
113 0.4
114 0.36
115 0.32
116 0.24
117 0.21
118 0.17
119 0.12
120 0.12
121 0.11