Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167LTG0

Protein Details
Accession A0A167LTG0    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
75-100DKVCCMKNGKCEKKLPKKINNETIDNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, cyto_nucl 6.5, nucl 6, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR025476  Helitron_helicase-like  
Pfam View protein in Pfam  
PF14214  Helitron_like_N  
Amino Acid Sequences MKFKELMKDLIKKKIFGKVQAFIYVIEFQKRGLSQAHILLIFHTDKSSDSVTKPLAYATVTKNMIHSLCDDKYNDKVCCMKNGKCEKKLPKKINNETIDNGNGYPLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.52
3 0.51
4 0.52
5 0.48
6 0.48
7 0.48
8 0.46
9 0.37
10 0.35
11 0.31
12 0.25
13 0.22
14 0.19
15 0.16
16 0.19
17 0.19
18 0.18
19 0.16
20 0.17
21 0.17
22 0.19
23 0.21
24 0.17
25 0.17
26 0.15
27 0.16
28 0.13
29 0.11
30 0.09
31 0.07
32 0.08
33 0.1
34 0.12
35 0.11
36 0.11
37 0.14
38 0.15
39 0.15
40 0.14
41 0.12
42 0.11
43 0.1
44 0.12
45 0.11
46 0.16
47 0.17
48 0.17
49 0.17
50 0.19
51 0.18
52 0.16
53 0.16
54 0.15
55 0.15
56 0.17
57 0.18
58 0.19
59 0.25
60 0.3
61 0.29
62 0.27
63 0.33
64 0.32
65 0.4
66 0.44
67 0.42
68 0.46
69 0.57
70 0.63
71 0.63
72 0.71
73 0.73
74 0.78
75 0.85
76 0.85
77 0.84
78 0.86
79 0.89
80 0.9
81 0.85
82 0.78
83 0.71
84 0.66
85 0.59
86 0.49
87 0.39