Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2H0Y0

Protein Details
Accession I2H0Y0    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
182-204ITTGTVLSKKRSRKNKKNNKLLLHydrophilic
NLS Segment(s)
PositionSequence
190-200KKRSRKNKKNN
Subcellular Location(s) mito 14, nucl 11.5, cyto_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR034600  MRPL36_yeast  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG tbl:TBLA_0C02200  -  
Amino Acid Sequences MFGSLRNNIAKRPVNSTKSSLICLNNSIRYASGYRPVQQVTLPQRPLKKIRVGKARPAIYYNFETLVELSDGSVIKRKSQLPKNEIRLIQDQRNNALWNPLELTLKDADAESALNKKNNLNKFNLKYNSIFQDLSLAKEKPSEATTTDNVMEIKEPIKTTESAPSDGLDDYLSLLSEDSEQITTGTVLSKKRSRKNKKNNKLLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.56
3 0.58
4 0.57
5 0.52
6 0.52
7 0.48
8 0.42
9 0.38
10 0.39
11 0.39
12 0.35
13 0.33
14 0.31
15 0.26
16 0.26
17 0.26
18 0.23
19 0.27
20 0.26
21 0.28
22 0.31
23 0.32
24 0.3
25 0.29
26 0.35
27 0.35
28 0.4
29 0.41
30 0.41
31 0.46
32 0.51
33 0.57
34 0.55
35 0.56
36 0.55
37 0.6
38 0.67
39 0.66
40 0.69
41 0.71
42 0.68
43 0.6
44 0.56
45 0.49
46 0.43
47 0.41
48 0.33
49 0.25
50 0.21
51 0.2
52 0.17
53 0.16
54 0.11
55 0.08
56 0.07
57 0.08
58 0.08
59 0.08
60 0.13
61 0.11
62 0.13
63 0.18
64 0.23
65 0.3
66 0.38
67 0.47
68 0.49
69 0.57
70 0.62
71 0.64
72 0.6
73 0.55
74 0.55
75 0.5
76 0.49
77 0.44
78 0.38
79 0.34
80 0.35
81 0.32
82 0.25
83 0.24
84 0.18
85 0.15
86 0.15
87 0.14
88 0.13
89 0.11
90 0.13
91 0.1
92 0.1
93 0.1
94 0.08
95 0.07
96 0.06
97 0.06
98 0.05
99 0.09
100 0.11
101 0.12
102 0.13
103 0.17
104 0.23
105 0.3
106 0.33
107 0.34
108 0.41
109 0.43
110 0.51
111 0.51
112 0.47
113 0.42
114 0.42
115 0.4
116 0.34
117 0.31
118 0.22
119 0.26
120 0.23
121 0.24
122 0.25
123 0.22
124 0.19
125 0.21
126 0.21
127 0.16
128 0.18
129 0.16
130 0.14
131 0.18
132 0.19
133 0.2
134 0.2
135 0.19
136 0.18
137 0.17
138 0.16
139 0.12
140 0.12
141 0.12
142 0.12
143 0.12
144 0.15
145 0.15
146 0.16
147 0.24
148 0.26
149 0.25
150 0.25
151 0.24
152 0.23
153 0.22
154 0.21
155 0.12
156 0.09
157 0.09
158 0.08
159 0.08
160 0.06
161 0.06
162 0.06
163 0.07
164 0.07
165 0.08
166 0.08
167 0.08
168 0.08
169 0.09
170 0.09
171 0.08
172 0.12
173 0.14
174 0.17
175 0.25
176 0.32
177 0.41
178 0.5
179 0.61
180 0.68
181 0.76
182 0.84
183 0.89
184 0.92