Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2GZ23

Protein Details
Accession I2GZ23    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
235-257DLNEKKFKTLRRRLPVSRARVNWHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 12, cyto 6.5, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002189  CapZ_alpha  
IPR037282  CapZ_alpha/beta  
IPR042276  CapZ_alpha/beta_2  
IPR042489  CapZ_alpha_1  
Gene Ontology GO:0008290  C:F-actin capping protein complex  
GO:0003779  F:actin binding  
GO:0051016  P:barbed-end actin filament capping  
KEGG tbl:TBLA_0B05460  -  
Pfam View protein in Pfam  
PF01267  F-actin_cap_A  
Amino Acid Sequences MSKFSTIISQIIEDSPAGEIKEVYDDLIKITGEDSKSIILDAIEAYNVKNNLPIKVNGESVILSEYNKIGSKYYDPVNNKLFSVDHLNYTPLDIEPVDNDDKINKLTPSLRGLLDALKEYAKKDYTGNVSVAVYPDNASSDNDSNKFEIIIISDKYNLNNFWTGIWRSKYIYDPSLNNQLTGKIDLNVHYFEGGNVTFNSEKSFKEDNVNLSEILKTIKSFESDFEKQLDVSFNDLNEKKFKTLRRRLPVSRARVNWGSSMGNYRLGKNAAENK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.12
4 0.11
5 0.1
6 0.1
7 0.09
8 0.13
9 0.13
10 0.12
11 0.13
12 0.13
13 0.13
14 0.15
15 0.14
16 0.11
17 0.12
18 0.15
19 0.14
20 0.15
21 0.15
22 0.14
23 0.14
24 0.14
25 0.14
26 0.09
27 0.09
28 0.09
29 0.08
30 0.08
31 0.08
32 0.08
33 0.12
34 0.13
35 0.12
36 0.16
37 0.17
38 0.2
39 0.23
40 0.25
41 0.25
42 0.27
43 0.28
44 0.24
45 0.23
46 0.2
47 0.17
48 0.17
49 0.13
50 0.1
51 0.1
52 0.1
53 0.11
54 0.12
55 0.12
56 0.12
57 0.13
58 0.16
59 0.18
60 0.22
61 0.28
62 0.3
63 0.35
64 0.39
65 0.38
66 0.36
67 0.33
68 0.29
69 0.23
70 0.28
71 0.23
72 0.2
73 0.2
74 0.21
75 0.19
76 0.19
77 0.18
78 0.1
79 0.1
80 0.08
81 0.08
82 0.07
83 0.11
84 0.12
85 0.11
86 0.11
87 0.11
88 0.12
89 0.13
90 0.15
91 0.11
92 0.12
93 0.14
94 0.17
95 0.19
96 0.21
97 0.19
98 0.18
99 0.18
100 0.18
101 0.16
102 0.14
103 0.12
104 0.11
105 0.11
106 0.11
107 0.14
108 0.13
109 0.13
110 0.13
111 0.16
112 0.19
113 0.21
114 0.2
115 0.18
116 0.18
117 0.17
118 0.17
119 0.13
120 0.09
121 0.07
122 0.07
123 0.06
124 0.07
125 0.07
126 0.09
127 0.1
128 0.12
129 0.13
130 0.14
131 0.14
132 0.13
133 0.13
134 0.11
135 0.09
136 0.08
137 0.09
138 0.09
139 0.09
140 0.12
141 0.12
142 0.13
143 0.14
144 0.13
145 0.12
146 0.13
147 0.13
148 0.11
149 0.14
150 0.16
151 0.19
152 0.21
153 0.2
154 0.2
155 0.22
156 0.25
157 0.25
158 0.27
159 0.25
160 0.26
161 0.28
162 0.37
163 0.35
164 0.32
165 0.29
166 0.26
167 0.24
168 0.25
169 0.22
170 0.13
171 0.14
172 0.15
173 0.17
174 0.16
175 0.15
176 0.13
177 0.12
178 0.1
179 0.12
180 0.1
181 0.09
182 0.08
183 0.11
184 0.12
185 0.12
186 0.15
187 0.15
188 0.15
189 0.2
190 0.23
191 0.22
192 0.28
193 0.31
194 0.32
195 0.34
196 0.35
197 0.29
198 0.27
199 0.25
200 0.19
201 0.18
202 0.14
203 0.1
204 0.12
205 0.13
206 0.15
207 0.15
208 0.17
209 0.24
210 0.27
211 0.28
212 0.28
213 0.27
214 0.25
215 0.26
216 0.27
217 0.19
218 0.2
219 0.19
220 0.18
221 0.25
222 0.26
223 0.28
224 0.29
225 0.31
226 0.32
227 0.37
228 0.45
229 0.49
230 0.57
231 0.65
232 0.7
233 0.77
234 0.8
235 0.84
236 0.85
237 0.83
238 0.82
239 0.74
240 0.71
241 0.67
242 0.62
243 0.53
244 0.47
245 0.41
246 0.33
247 0.36
248 0.3
249 0.34
250 0.33
251 0.32
252 0.34
253 0.34
254 0.33