Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162TF19

Protein Details
Accession A0A162TF19    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
306-327LGSNSEPPKKPKRPQSRLVDTSHydrophilic
NLS Segment(s)
PositionSequence
313-318PKKPKR
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR043560  ZGPAT  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
GO:0045892  P:negative regulation of DNA-templated transcription  
Amino Acid Sequences MSSSLEETKAMIQQVEELIALAPTDDSLLTMLADLYDVLEKAMAEQLPEEKEEEEEEEKEKDAFPCGTQCVISFTLDDRQYLLPALVLERLALSNEAKVLILTPITADTVACTNHIVKHACKTPCPDQRSHGYLVPAENLLPYDILGISDIENYRPSKRVWCKVDKTTTVWQVGRIVGQDGSTDNQWRVQCASDMSTLHTLGIESIMPYKIHDTKNDTTDNDTTTSDNDDNEHYVDGQNDPEHESEHESDHELERCGKECFYWPAYRFNHQGKGLGLHGQGRIDPVEAFMPNVKKRSIPGQDRPGLGSNSEPPKKPKRPQSRLVDTSVFAFMNKTLSKPKEEEEEEEEANSNDKNKDKKQDREGANKGSRKPVAAITLNPKETQRQLHALQTEIAQTSETLARAHESVRRNKGTPMESQFVAKVDRVAKALAGLQKQADRLQGTLKRTKEREKMVSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.15
4 0.12
5 0.11
6 0.1
7 0.1
8 0.07
9 0.06
10 0.05
11 0.06
12 0.05
13 0.05
14 0.06
15 0.06
16 0.06
17 0.06
18 0.06
19 0.05
20 0.06
21 0.05
22 0.06
23 0.07
24 0.07
25 0.07
26 0.07
27 0.07
28 0.08
29 0.13
30 0.12
31 0.11
32 0.13
33 0.17
34 0.18
35 0.19
36 0.19
37 0.15
38 0.16
39 0.17
40 0.2
41 0.19
42 0.19
43 0.2
44 0.2
45 0.21
46 0.21
47 0.21
48 0.18
49 0.2
50 0.19
51 0.19
52 0.21
53 0.23
54 0.23
55 0.21
56 0.21
57 0.21
58 0.21
59 0.2
60 0.17
61 0.17
62 0.23
63 0.23
64 0.23
65 0.21
66 0.2
67 0.2
68 0.2
69 0.18
70 0.11
71 0.11
72 0.12
73 0.1
74 0.09
75 0.09
76 0.09
77 0.09
78 0.09
79 0.1
80 0.09
81 0.09
82 0.1
83 0.1
84 0.09
85 0.09
86 0.09
87 0.08
88 0.07
89 0.06
90 0.06
91 0.06
92 0.07
93 0.07
94 0.06
95 0.06
96 0.08
97 0.09
98 0.09
99 0.1
100 0.11
101 0.13
102 0.19
103 0.21
104 0.2
105 0.27
106 0.35
107 0.35
108 0.37
109 0.42
110 0.47
111 0.53
112 0.57
113 0.53
114 0.5
115 0.55
116 0.56
117 0.53
118 0.46
119 0.39
120 0.35
121 0.33
122 0.29
123 0.22
124 0.17
125 0.14
126 0.11
127 0.1
128 0.08
129 0.06
130 0.06
131 0.05
132 0.05
133 0.06
134 0.06
135 0.06
136 0.08
137 0.09
138 0.09
139 0.12
140 0.14
141 0.15
142 0.17
143 0.18
144 0.26
145 0.34
146 0.42
147 0.47
148 0.55
149 0.6
150 0.66
151 0.72
152 0.66
153 0.63
154 0.61
155 0.58
156 0.53
157 0.47
158 0.4
159 0.34
160 0.32
161 0.27
162 0.2
163 0.16
164 0.11
165 0.11
166 0.1
167 0.09
168 0.09
169 0.09
170 0.1
171 0.1
172 0.14
173 0.14
174 0.15
175 0.15
176 0.15
177 0.15
178 0.14
179 0.16
180 0.14
181 0.14
182 0.15
183 0.16
184 0.15
185 0.14
186 0.12
187 0.1
188 0.08
189 0.08
190 0.05
191 0.04
192 0.06
193 0.07
194 0.07
195 0.07
196 0.1
197 0.16
198 0.17
199 0.2
200 0.25
201 0.28
202 0.32
203 0.35
204 0.32
205 0.3
206 0.3
207 0.28
208 0.23
209 0.2
210 0.16
211 0.14
212 0.16
213 0.13
214 0.12
215 0.12
216 0.11
217 0.11
218 0.11
219 0.11
220 0.08
221 0.08
222 0.09
223 0.08
224 0.08
225 0.08
226 0.08
227 0.09
228 0.09
229 0.09
230 0.09
231 0.12
232 0.12
233 0.13
234 0.13
235 0.12
236 0.13
237 0.14
238 0.15
239 0.13
240 0.15
241 0.14
242 0.16
243 0.15
244 0.14
245 0.13
246 0.15
247 0.19
248 0.2
249 0.25
250 0.25
251 0.34
252 0.36
253 0.4
254 0.42
255 0.41
256 0.44
257 0.39
258 0.39
259 0.31
260 0.31
261 0.28
262 0.25
263 0.22
264 0.18
265 0.18
266 0.16
267 0.15
268 0.14
269 0.13
270 0.11
271 0.1
272 0.08
273 0.09
274 0.09
275 0.09
276 0.12
277 0.17
278 0.19
279 0.21
280 0.21
281 0.2
282 0.22
283 0.3
284 0.36
285 0.39
286 0.45
287 0.52
288 0.56
289 0.56
290 0.57
291 0.52
292 0.43
293 0.35
294 0.28
295 0.25
296 0.3
297 0.32
298 0.32
299 0.35
300 0.46
301 0.55
302 0.61
303 0.65
304 0.68
305 0.73
306 0.81
307 0.84
308 0.84
309 0.79
310 0.76
311 0.68
312 0.56
313 0.5
314 0.42
315 0.31
316 0.21
317 0.17
318 0.12
319 0.15
320 0.15
321 0.15
322 0.21
323 0.23
324 0.28
325 0.3
326 0.32
327 0.35
328 0.37
329 0.39
330 0.37
331 0.39
332 0.34
333 0.33
334 0.31
335 0.23
336 0.22
337 0.18
338 0.16
339 0.15
340 0.2
341 0.27
342 0.32
343 0.43
344 0.51
345 0.6
346 0.66
347 0.72
348 0.75
349 0.78
350 0.78
351 0.78
352 0.77
353 0.74
354 0.68
355 0.67
356 0.61
357 0.52
358 0.47
359 0.41
360 0.39
361 0.36
362 0.38
363 0.39
364 0.44
365 0.44
366 0.43
367 0.41
368 0.38
369 0.4
370 0.41
371 0.37
372 0.37
373 0.38
374 0.43
375 0.44
376 0.4
377 0.37
378 0.32
379 0.29
380 0.23
381 0.21
382 0.14
383 0.12
384 0.13
385 0.15
386 0.14
387 0.12
388 0.11
389 0.13
390 0.14
391 0.16
392 0.2
393 0.26
394 0.35
395 0.44
396 0.49
397 0.49
398 0.53
399 0.59
400 0.56
401 0.56
402 0.54
403 0.49
404 0.44
405 0.45
406 0.41
407 0.36
408 0.35
409 0.27
410 0.25
411 0.23
412 0.25
413 0.24
414 0.24
415 0.22
416 0.21
417 0.25
418 0.26
419 0.25
420 0.25
421 0.27
422 0.29
423 0.32
424 0.32
425 0.33
426 0.28
427 0.28
428 0.34
429 0.37
430 0.42
431 0.47
432 0.51
433 0.55
434 0.6
435 0.69
436 0.68
437 0.72