Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162V171

Protein Details
Accession A0A162V171    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
53-72GSKRVFQKIKKRYKEKQAIDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, cyto_nucl 10, nucl 7.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MLISQCKSSLLKKSLIKTTCVFENSERALVTLAINEKKIWSGKSCLCLEGNDGSKRVFQKIKKRYKEKQAIDTVKQSGGGIMFLSERFGPLKVIKSESVNQDKYIDTLAQALLH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.54
3 0.54
4 0.46
5 0.46
6 0.43
7 0.39
8 0.35
9 0.28
10 0.33
11 0.31
12 0.31
13 0.27
14 0.22
15 0.21
16 0.19
17 0.17
18 0.13
19 0.15
20 0.14
21 0.15
22 0.15
23 0.14
24 0.16
25 0.18
26 0.17
27 0.16
28 0.2
29 0.22
30 0.28
31 0.29
32 0.28
33 0.27
34 0.25
35 0.24
36 0.23
37 0.25
38 0.2
39 0.2
40 0.18
41 0.2
42 0.21
43 0.23
44 0.24
45 0.25
46 0.34
47 0.44
48 0.54
49 0.61
50 0.69
51 0.73
52 0.79
53 0.84
54 0.79
55 0.77
56 0.77
57 0.73
58 0.68
59 0.64
60 0.55
61 0.45
62 0.39
63 0.3
64 0.21
65 0.15
66 0.12
67 0.07
68 0.06
69 0.06
70 0.06
71 0.08
72 0.07
73 0.07
74 0.08
75 0.09
76 0.11
77 0.13
78 0.2
79 0.21
80 0.25
81 0.26
82 0.3
83 0.34
84 0.41
85 0.47
86 0.43
87 0.41
88 0.4
89 0.38
90 0.35
91 0.32
92 0.24
93 0.15
94 0.16