Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167PY01

Protein Details
Accession A0A167PY01   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
25-49KTRNTFCKGGKCKKHTPHKVTQYKAHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 12, mito 6, plas 3, E.R. 3, cyto_mito 3, mito_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MLISIAIIVLTCFALSSTTFVNIPKTRNTFCKGGKCKKHTPHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKIVLRLECTACKYKMQLSIKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.06
3 0.08
4 0.08
5 0.1
6 0.11
7 0.12
8 0.19
9 0.22
10 0.24
11 0.3
12 0.34
13 0.36
14 0.42
15 0.46
16 0.45
17 0.48
18 0.56
19 0.59
20 0.64
21 0.7
22 0.72
23 0.77
24 0.79
25 0.84
26 0.84
27 0.83
28 0.82
29 0.83
30 0.84
31 0.77
32 0.77
33 0.73
34 0.66
35 0.61
36 0.53
37 0.42
38 0.34
39 0.34
40 0.32
41 0.27
42 0.25
43 0.31
44 0.34
45 0.38
46 0.43
47 0.47
48 0.43
49 0.5
50 0.57
51 0.54
52 0.56
53 0.55
54 0.55
55 0.54
56 0.57
57 0.49
58 0.44
59 0.41
60 0.34
61 0.37
62 0.39
63 0.38
64 0.33
65 0.4
66 0.44
67 0.53
68 0.61
69 0.64
70 0.63
71 0.67
72 0.74
73 0.74
74 0.73
75 0.7
76 0.65
77 0.62
78 0.6
79 0.55
80 0.5
81 0.47
82 0.41
83 0.35
84 0.33
85 0.32
86 0.36
87 0.42
88 0.46
89 0.49
90 0.58
91 0.65
92 0.71
93 0.68
94 0.62
95 0.59
96 0.54
97 0.54
98 0.54
99 0.54
100 0.55
101 0.58
102 0.54
103 0.51
104 0.49
105 0.42