Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167LCY7

Protein Details
Accession A0A167LCY7   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
50-78SLSTVKYIVKRRNKKRSPKPRKGYGISRKHydrophilic
NLS Segment(s)
PositionSequence
59-73KRRNKKRSPKPRKGY
Subcellular Location(s) nucl 16, mito 8, cyto 2
Family & Domain DBs
Amino Acid Sequences MNIRGLSTKTFKQLEGLVFFHCQLDREEYNAFDERDDFDSTHTSLVVDMSLSTVKYIVKRRNKKRSPKPRKGYGISRKIYDWTERHLMRVVRKGNAVSYYWMGKSLNKIEVFVCRKTIISYLKRLSFESYIAAHEPDLTEPKEERIGLDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.35
3 0.33
4 0.28
5 0.27
6 0.27
7 0.26
8 0.22
9 0.18
10 0.16
11 0.21
12 0.2
13 0.21
14 0.22
15 0.21
16 0.25
17 0.27
18 0.25
19 0.18
20 0.19
21 0.19
22 0.2
23 0.21
24 0.17
25 0.15
26 0.17
27 0.17
28 0.17
29 0.14
30 0.11
31 0.09
32 0.09
33 0.08
34 0.05
35 0.04
36 0.05
37 0.06
38 0.06
39 0.05
40 0.06
41 0.07
42 0.12
43 0.19
44 0.27
45 0.37
46 0.48
47 0.58
48 0.69
49 0.77
50 0.84
51 0.88
52 0.9
53 0.91
54 0.92
55 0.9
56 0.89
57 0.87
58 0.82
59 0.81
60 0.8
61 0.78
62 0.69
63 0.61
64 0.52
65 0.46
66 0.42
67 0.37
68 0.28
69 0.23
70 0.29
71 0.27
72 0.28
73 0.31
74 0.32
75 0.31
76 0.37
77 0.35
78 0.3
79 0.31
80 0.3
81 0.28
82 0.27
83 0.24
84 0.19
85 0.18
86 0.17
87 0.16
88 0.17
89 0.15
90 0.15
91 0.19
92 0.2
93 0.25
94 0.23
95 0.24
96 0.23
97 0.32
98 0.35
99 0.31
100 0.29
101 0.24
102 0.24
103 0.25
104 0.3
105 0.3
106 0.3
107 0.37
108 0.41
109 0.46
110 0.47
111 0.47
112 0.45
113 0.38
114 0.34
115 0.29
116 0.24
117 0.21
118 0.21
119 0.21
120 0.16
121 0.15
122 0.15
123 0.15
124 0.18
125 0.17
126 0.19
127 0.2
128 0.23
129 0.27
130 0.26