Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167N6A7

Protein Details
Accession A0A167N6A7   
Localization Confidence Medium
Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
14-38VSLPGVNQKKRPRRKYHEVERLYQCHydrophilic
63-89GLKRHPNEFKELRKQWRRQKRENQALAHydrophilic
NLS Segment(s)
PositionSequence
23-27KRPRR
Subcellular Location(s) mito 15, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR039327  CON7-like  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0006355  P:regulation of DNA-templated transcription  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
Amino Acid Sequences SQQALDQSKVFSFVSLPGVNQKKRPRRKYHEVERLYQCNFPDCTKAYGTLNHLNAHVCMQGHGLKRHPNEFKELRKQWRRQKRENQALA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.17
3 0.17
4 0.24
5 0.31
6 0.33
7 0.4
8 0.49
9 0.53
10 0.64
11 0.74
12 0.76
13 0.78
14 0.86
15 0.89
16 0.9
17 0.9
18 0.83
19 0.81
20 0.77
21 0.72
22 0.62
23 0.54
24 0.43
25 0.36
26 0.33
27 0.26
28 0.23
29 0.19
30 0.2
31 0.18
32 0.2
33 0.17
34 0.18
35 0.22
36 0.24
37 0.25
38 0.23
39 0.23
40 0.22
41 0.21
42 0.2
43 0.16
44 0.1
45 0.09
46 0.1
47 0.15
48 0.19
49 0.21
50 0.24
51 0.3
52 0.34
53 0.41
54 0.45
55 0.42
56 0.47
57 0.52
58 0.57
59 0.61
60 0.66
61 0.69
62 0.73
63 0.81
64 0.83
65 0.86
66 0.87
67 0.87
68 0.9
69 0.91