Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167P6W9

Protein Details
Accession A0A167P6W9   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
118-140GELHFFRQRRPYKVWRPRLFRLGHydrophilic
NLS Segment(s)
PositionSequence
112-117KKSKDK
126-127RR
Subcellular Location(s) nucl 11, cyto_nucl 8.833, mito 7.5, cyto_mito 6.666, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MLITKYFPIRFYLSNARKIVCTEMEMISRRKFELVHVKHACHENDNVLGSFVALLVKNKHLCSIDYNIYEIGTSLLLVICLCEIRTHALPTKVGKTPVKPTKNLTIDRDGGKKSKDKGELHFFRQRRPYKVWRPRLFRLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.5
3 0.46
4 0.43
5 0.43
6 0.41
7 0.32
8 0.28
9 0.22
10 0.22
11 0.26
12 0.28
13 0.31
14 0.3
15 0.3
16 0.28
17 0.26
18 0.24
19 0.26
20 0.33
21 0.34
22 0.41
23 0.43
24 0.43
25 0.45
26 0.51
27 0.45
28 0.36
29 0.33
30 0.25
31 0.23
32 0.24
33 0.2
34 0.15
35 0.14
36 0.11
37 0.1
38 0.08
39 0.06
40 0.05
41 0.07
42 0.08
43 0.12
44 0.14
45 0.14
46 0.16
47 0.16
48 0.17
49 0.19
50 0.22
51 0.23
52 0.21
53 0.22
54 0.19
55 0.18
56 0.17
57 0.14
58 0.09
59 0.05
60 0.04
61 0.04
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.04
71 0.08
72 0.09
73 0.12
74 0.15
75 0.17
76 0.2
77 0.22
78 0.26
79 0.26
80 0.3
81 0.31
82 0.31
83 0.39
84 0.47
85 0.5
86 0.48
87 0.5
88 0.54
89 0.59
90 0.6
91 0.55
92 0.51
93 0.5
94 0.51
95 0.51
96 0.44
97 0.41
98 0.4
99 0.41
100 0.39
101 0.44
102 0.48
103 0.48
104 0.53
105 0.6
106 0.62
107 0.63
108 0.68
109 0.61
110 0.61
111 0.67
112 0.66
113 0.62
114 0.64
115 0.68
116 0.7
117 0.79
118 0.82
119 0.82
120 0.83