Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162UX99

Protein Details
Accession A0A162UX99   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
4-32QPLPDKGRCSHYRKSKRWFRFPCCQKLYPHydrophilic
NLS Segment(s)
PositionSequence
95-104MSRKDTRKHK
Subcellular Location(s) mito 12, nucl 10.5, cyto_nucl 8, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008913  Znf_CHY  
IPR037274  Znf_CHY_sf  
Gene Ontology GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF05495  zf-CHY  
PROSITE View protein in PROSITE  
PS51266  ZF_CHY  
Amino Acid Sequences VCGQPLPDKGRCSHYRKSKRWFRFPCCQKLYPCNTCHDLDQDHPYTYAQRHVCGMCSREQAIMPLCTGCNHAFEPDQHKGAFWEGGQGMRDKTKMSRKDTRKHK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.68
3 0.74
4 0.82
5 0.83
6 0.85
7 0.89
8 0.89
9 0.86
10 0.86
11 0.86
12 0.86
13 0.83
14 0.78
15 0.72
16 0.71
17 0.73
18 0.69
19 0.62
20 0.56
21 0.52
22 0.48
23 0.44
24 0.38
25 0.31
26 0.26
27 0.3
28 0.27
29 0.24
30 0.23
31 0.22
32 0.21
33 0.19
34 0.23
35 0.18
36 0.16
37 0.18
38 0.18
39 0.2
40 0.2
41 0.21
42 0.17
43 0.19
44 0.19
45 0.18
46 0.18
47 0.18
48 0.18
49 0.16
50 0.13
51 0.12
52 0.11
53 0.11
54 0.14
55 0.12
56 0.12
57 0.12
58 0.14
59 0.15
60 0.17
61 0.24
62 0.25
63 0.27
64 0.24
65 0.24
66 0.24
67 0.24
68 0.23
69 0.15
70 0.17
71 0.15
72 0.17
73 0.18
74 0.19
75 0.19
76 0.2
77 0.21
78 0.19
79 0.26
80 0.34
81 0.41
82 0.47
83 0.56
84 0.62