Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A162Q9Y9

Protein Details
Accession A0A162Q9Y9    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
90-122LAGRNRFSRCRTRKIRIKKYFSKLKGRRNDQKEHydrophilic
NLS Segment(s)
PositionSequence
79-119KIHRAKSLSEKLAGRNRFSRCRTRKIRIKKYFSKLKGRRND
Subcellular Location(s) nucl 12.5, mito 10, cyto_nucl 9.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences METYPTFSIVIKQLCAFVIRSQTQAVMTATPLNIDEGTFSISNRPIVSMVQSYIHMQPEVEYVLSSVVEEKARRHLSYKIHRAKSLSEKLAGRNRFSRCRTRKIRIKKYFSKLKGRRNDQKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.2
4 0.17
5 0.22
6 0.22
7 0.23
8 0.23
9 0.23
10 0.22
11 0.23
12 0.2
13 0.13
14 0.13
15 0.13
16 0.12
17 0.12
18 0.11
19 0.1
20 0.09
21 0.08
22 0.08
23 0.07
24 0.1
25 0.09
26 0.09
27 0.11
28 0.12
29 0.13
30 0.13
31 0.13
32 0.1
33 0.11
34 0.13
35 0.11
36 0.11
37 0.1
38 0.11
39 0.12
40 0.13
41 0.13
42 0.11
43 0.1
44 0.1
45 0.1
46 0.09
47 0.07
48 0.06
49 0.05
50 0.05
51 0.05
52 0.05
53 0.05
54 0.05
55 0.07
56 0.08
57 0.09
58 0.17
59 0.2
60 0.21
61 0.22
62 0.27
63 0.35
64 0.44
65 0.54
66 0.56
67 0.57
68 0.58
69 0.58
70 0.58
71 0.58
72 0.56
73 0.48
74 0.43
75 0.42
76 0.47
77 0.54
78 0.51
79 0.45
80 0.44
81 0.48
82 0.52
83 0.56
84 0.6
85 0.59
86 0.66
87 0.72
88 0.75
89 0.79
90 0.82
91 0.87
92 0.87
93 0.9
94 0.89
95 0.9
96 0.9
97 0.88
98 0.88
99 0.86
100 0.86
101 0.87
102 0.87