Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2H500

Protein Details
Accession I2H500    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
6-36YLSKTYGPAKKEKSKKKSKKQTKGVFDDNETHydrophilic
NLS Segment(s)
PositionSequence
14-26AKKEKSKKKSKKQ
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR018609  Bud13  
Gene Ontology GO:0005681  C:spliceosomal complex  
KEGG tbl:TBLA_0E03970  -  
Pfam View protein in Pfam  
PF09736  Bud13  
Amino Acid Sequences MSINDYLSKTYGPAKKEKSKKKSKKQTKGVFDDNETLISYTSAKQEQKTEKLSTLNITDSSNVTTLNNIPLSSAPTTLNSKSRKDNKNLWKNLSTNELSIQNNEPDIKKQEKSNIIKLSSGAHAGLQTAEDVEKQLKVNEESAKQLANSALSPNAQNAPTIYRDRFGRRIKNIDLQREEESSKEESRKKIQEKSLREFNMGELQKYMLDNNLKNPPSIQNASSARQKALKDLEDPLANFNSDISSISKTPKTAPHTFFGRKIYTKAYPENRFGIAPGWRWDGVDRSNGFEPKWLAKRDELETKRVEKYTMQEEF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.55
3 0.65
4 0.74
5 0.76
6 0.83
7 0.9
8 0.92
9 0.94
10 0.95
11 0.96
12 0.96
13 0.95
14 0.94
15 0.92
16 0.9
17 0.83
18 0.76
19 0.7
20 0.6
21 0.5
22 0.4
23 0.32
24 0.23
25 0.18
26 0.16
27 0.13
28 0.16
29 0.21
30 0.23
31 0.25
32 0.34
33 0.41
34 0.46
35 0.5
36 0.5
37 0.47
38 0.47
39 0.47
40 0.42
41 0.36
42 0.32
43 0.27
44 0.24
45 0.22
46 0.2
47 0.2
48 0.16
49 0.14
50 0.12
51 0.13
52 0.13
53 0.16
54 0.16
55 0.14
56 0.14
57 0.14
58 0.17
59 0.16
60 0.17
61 0.13
62 0.15
63 0.2
64 0.22
65 0.28
66 0.29
67 0.32
68 0.41
69 0.5
70 0.55
71 0.58
72 0.66
73 0.69
74 0.76
75 0.79
76 0.76
77 0.72
78 0.66
79 0.61
80 0.57
81 0.47
82 0.37
83 0.33
84 0.31
85 0.25
86 0.26
87 0.26
88 0.2
89 0.2
90 0.21
91 0.19
92 0.18
93 0.23
94 0.25
95 0.25
96 0.27
97 0.33
98 0.41
99 0.45
100 0.5
101 0.51
102 0.48
103 0.46
104 0.44
105 0.38
106 0.3
107 0.25
108 0.17
109 0.11
110 0.1
111 0.09
112 0.09
113 0.06
114 0.05
115 0.05
116 0.05
117 0.05
118 0.05
119 0.06
120 0.07
121 0.08
122 0.09
123 0.11
124 0.12
125 0.15
126 0.18
127 0.18
128 0.19
129 0.2
130 0.19
131 0.16
132 0.16
133 0.13
134 0.1
135 0.1
136 0.08
137 0.08
138 0.08
139 0.09
140 0.09
141 0.1
142 0.09
143 0.09
144 0.09
145 0.1
146 0.12
147 0.15
148 0.15
149 0.15
150 0.18
151 0.22
152 0.3
153 0.35
154 0.4
155 0.42
156 0.48
157 0.49
158 0.55
159 0.55
160 0.54
161 0.51
162 0.46
163 0.43
164 0.39
165 0.36
166 0.28
167 0.26
168 0.21
169 0.21
170 0.24
171 0.26
172 0.28
173 0.35
174 0.43
175 0.46
176 0.51
177 0.56
178 0.59
179 0.63
180 0.66
181 0.68
182 0.6
183 0.57
184 0.49
185 0.42
186 0.42
187 0.35
188 0.28
189 0.2
190 0.19
191 0.18
192 0.18
193 0.17
194 0.12
195 0.16
196 0.17
197 0.21
198 0.29
199 0.28
200 0.28
201 0.29
202 0.29
203 0.3
204 0.32
205 0.28
206 0.28
207 0.31
208 0.34
209 0.39
210 0.37
211 0.33
212 0.35
213 0.35
214 0.33
215 0.35
216 0.34
217 0.3
218 0.31
219 0.33
220 0.31
221 0.31
222 0.28
223 0.24
224 0.21
225 0.19
226 0.15
227 0.12
228 0.1
229 0.11
230 0.1
231 0.12
232 0.13
233 0.18
234 0.2
235 0.2
236 0.24
237 0.3
238 0.35
239 0.41
240 0.43
241 0.45
242 0.51
243 0.54
244 0.55
245 0.53
246 0.52
247 0.46
248 0.46
249 0.46
250 0.44
251 0.46
252 0.5
253 0.55
254 0.54
255 0.56
256 0.56
257 0.52
258 0.45
259 0.41
260 0.36
261 0.31
262 0.29
263 0.28
264 0.29
265 0.28
266 0.28
267 0.29
268 0.3
269 0.28
270 0.32
271 0.29
272 0.3
273 0.36
274 0.37
275 0.35
276 0.35
277 0.36
278 0.37
279 0.43
280 0.42
281 0.4
282 0.44
283 0.49
284 0.5
285 0.57
286 0.52
287 0.51
288 0.54
289 0.56
290 0.57
291 0.52
292 0.48
293 0.42
294 0.44