Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167QKF5

Protein Details
Accession A0A167QKF5    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
98-122YERSLKTVKYQKKQAHFPMRKYAVKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 11.5, cyto 6.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
Amino Acid Sequences MVAVKAHQLRNKNKAELLKVLDEKKQELASLRVQKVAGGSASKLQAIGQARKNVARTLTVINQTQRDQLRLFYQKKKLIPIDLRVKKTRALRRALTPYERSLKTVKYQKKQAHFPMRKYAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.6
3 0.57
4 0.53
5 0.51
6 0.49
7 0.48
8 0.47
9 0.42
10 0.39
11 0.36
12 0.32
13 0.26
14 0.23
15 0.24
16 0.29
17 0.36
18 0.35
19 0.34
20 0.33
21 0.32
22 0.3
23 0.28
24 0.2
25 0.12
26 0.12
27 0.12
28 0.13
29 0.12
30 0.12
31 0.1
32 0.13
33 0.16
34 0.21
35 0.23
36 0.26
37 0.27
38 0.29
39 0.31
40 0.28
41 0.25
42 0.2
43 0.18
44 0.18
45 0.2
46 0.21
47 0.22
48 0.22
49 0.23
50 0.22
51 0.25
52 0.23
53 0.21
54 0.19
55 0.18
56 0.23
57 0.3
58 0.34
59 0.37
60 0.44
61 0.47
62 0.49
63 0.54
64 0.5
65 0.49
66 0.48
67 0.49
68 0.53
69 0.54
70 0.58
71 0.56
72 0.55
73 0.52
74 0.57
75 0.57
76 0.54
77 0.54
78 0.52
79 0.57
80 0.64
81 0.65
82 0.63
83 0.58
84 0.57
85 0.57
86 0.54
87 0.48
88 0.43
89 0.4
90 0.42
91 0.49
92 0.52
93 0.53
94 0.62
95 0.68
96 0.73
97 0.79
98 0.81
99 0.83
100 0.82
101 0.79
102 0.8
103 0.8