Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162Q6Q9

Protein Details
Accession A0A162Q6Q9    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
38-68ICHYHGQHRHSKKRQRKTNPPKKKIESKVNEBasic
NLS Segment(s)
PositionSequence
46-62RHSKKRQRKTNPPKKKI
Subcellular Location(s) nucl 19, mito 4, cyto 3
Family & Domain DBs
Amino Acid Sequences MQSIQYNTKESVIVCVSMNVFCISELRVLVKCYKVINICHYHGQHRHSKKRQRKTNPPKKKIESKVNETRTTSLVRRLYQQCNLDCLPNSYKVEYWKSLLCSVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.17
4 0.16
5 0.17
6 0.12
7 0.11
8 0.1
9 0.1
10 0.09
11 0.1
12 0.1
13 0.11
14 0.12
15 0.14
16 0.17
17 0.17
18 0.18
19 0.18
20 0.21
21 0.23
22 0.24
23 0.29
24 0.31
25 0.32
26 0.36
27 0.36
28 0.38
29 0.39
30 0.4
31 0.42
32 0.47
33 0.55
34 0.59
35 0.68
36 0.72
37 0.78
38 0.84
39 0.85
40 0.87
41 0.89
42 0.91
43 0.92
44 0.9
45 0.89
46 0.86
47 0.86
48 0.83
49 0.82
50 0.78
51 0.76
52 0.77
53 0.74
54 0.71
55 0.62
56 0.56
57 0.47
58 0.44
59 0.37
60 0.35
61 0.34
62 0.31
63 0.37
64 0.42
65 0.45
66 0.48
67 0.53
68 0.46
69 0.47
70 0.47
71 0.42
72 0.37
73 0.36
74 0.33
75 0.33
76 0.34
77 0.3
78 0.32
79 0.35
80 0.4
81 0.38
82 0.38
83 0.36
84 0.37