Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A163D922

Protein Details
Accession A0A163D922    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
13-46KVKSQTPKVAKQEKKKPKTGRAKKRQVYNRRFVNHydrophilic
NLS Segment(s)
PositionSequence
11-37AGKVKSQTPKVAKQEKKKPKTGRAKKR
Subcellular Location(s) nucl 12, mito 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVAKQEKKKPKTGRAKKRQVYNRRFVNVTATIGGKRRMNPAPTAGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.41
3 0.45
4 0.48
5 0.52
6 0.6
7 0.64
8 0.69
9 0.71
10 0.73
11 0.77
12 0.79
13 0.8
14 0.81
15 0.8
16 0.8
17 0.84
18 0.84
19 0.85
20 0.85
21 0.88
22 0.84
23 0.85
24 0.85
25 0.85
26 0.83
27 0.81
28 0.78
29 0.71
30 0.67
31 0.58
32 0.54
33 0.45
34 0.38
35 0.3
36 0.24
37 0.22
38 0.24
39 0.28
40 0.25
41 0.25
42 0.31
43 0.36
44 0.38
45 0.39