Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162Y3W7

Protein Details
Accession A0A162Y3W7    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MTCKRRNNGRNKHGRGHVKFBasic
81-107ARVVRVRSVKDRKNRAPPPRFRFQKTAHydrophilic
NLS Segment(s)
PositionSequence
90-100KDRKNRAPPPR
Subcellular Location(s) mito 17, cyto 5.5, cyto_nucl 5.5, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MTCKRRNNGRNKHGRGHVKFVRCINCSKCCPKDKAIKRFTIRNMVEAAAVRDLQEASIYEEYTIPKLYVKLHYCISCAIHARVVRVRSVKDRKNRAPPPRFRFQKTAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.8
3 0.78
4 0.75
5 0.7
6 0.68
7 0.66
8 0.64
9 0.55
10 0.57
11 0.53
12 0.53
13 0.54
14 0.57
15 0.58
16 0.58
17 0.61
18 0.62
19 0.66
20 0.69
21 0.73
22 0.71
23 0.72
24 0.69
25 0.71
26 0.68
27 0.67
28 0.58
29 0.49
30 0.43
31 0.34
32 0.31
33 0.24
34 0.21
35 0.12
36 0.11
37 0.09
38 0.08
39 0.07
40 0.06
41 0.06
42 0.06
43 0.08
44 0.08
45 0.08
46 0.08
47 0.09
48 0.1
49 0.11
50 0.11
51 0.08
52 0.08
53 0.09
54 0.11
55 0.18
56 0.2
57 0.22
58 0.25
59 0.26
60 0.26
61 0.27
62 0.26
63 0.22
64 0.23
65 0.21
66 0.22
67 0.22
68 0.25
69 0.28
70 0.28
71 0.29
72 0.3
73 0.33
74 0.38
75 0.47
76 0.52
77 0.57
78 0.67
79 0.71
80 0.78
81 0.84
82 0.85
83 0.86
84 0.89
85 0.86
86 0.87
87 0.85
88 0.82