Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167P1U6

Protein Details
Accession A0A167P1U6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
48-69QETLERVRKDWRKRNNGIGLRDHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 16, mito 8, cyto 2
Family & Domain DBs
Amino Acid Sequences MPKGTIISPKFWVLPVLLVSGAALISRSKTSPVQPNNYVLSGEKLGDQETLERVRKDWRKRNNGIGLRDVDRSGGGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.16
3 0.15
4 0.12
5 0.11
6 0.1
7 0.09
8 0.08
9 0.05
10 0.05
11 0.04
12 0.05
13 0.06
14 0.07
15 0.09
16 0.11
17 0.16
18 0.25
19 0.3
20 0.36
21 0.37
22 0.4
23 0.39
24 0.37
25 0.33
26 0.24
27 0.21
28 0.15
29 0.13
30 0.11
31 0.09
32 0.09
33 0.09
34 0.09
35 0.09
36 0.11
37 0.16
38 0.18
39 0.18
40 0.19
41 0.28
42 0.36
43 0.46
44 0.52
45 0.58
46 0.65
47 0.71
48 0.8
49 0.81
50 0.8
51 0.74
52 0.72
53 0.66
54 0.58
55 0.54
56 0.44
57 0.34