Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162NGE1

Protein Details
Accession A0A162NGE1    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
8-29DTIKINHLKNRRKQLRFAKSPIHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 10, nucl 8, mito 8, mito_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR003616  Post-SET_dom  
IPR044570  Set1-like  
IPR001214  SET_dom  
IPR046341  SET_dom_sf  
Gene Ontology GO:0005694  C:chromosome  
GO:0042800  F:histone H3K4 methyltransferase activity  
GO:0051568  P:histone H3-K4 methylation  
Pfam View protein in Pfam  
PF00856  SET  
PROSITE View protein in PROSITE  
PS50868  POST_SET  
PS50280  SET  
Amino Acid Sequences NKAAGESDTIKINHLKNRRKQLRFAKSPIHAWGLFAEEPIDANDIVIEYVGEVIRHQVAEKREKEYERTGIGSSYLFRVDNDRVIDATKRGNVARFINHCCAPNCVAKIVTIDKQKRIVIYSSRDIVPGEEITYDYKFPIEQEKIPCHCGSKFCKGRCVKLLNSREILY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.52
3 0.56
4 0.67
5 0.75
6 0.75
7 0.8
8 0.83
9 0.84
10 0.83
11 0.8
12 0.77
13 0.71
14 0.7
15 0.64
16 0.58
17 0.47
18 0.39
19 0.33
20 0.29
21 0.24
22 0.2
23 0.17
24 0.11
25 0.12
26 0.11
27 0.12
28 0.07
29 0.07
30 0.07
31 0.06
32 0.06
33 0.05
34 0.04
35 0.03
36 0.04
37 0.04
38 0.04
39 0.04
40 0.06
41 0.06
42 0.07
43 0.07
44 0.11
45 0.16
46 0.24
47 0.26
48 0.3
49 0.34
50 0.35
51 0.39
52 0.39
53 0.38
54 0.31
55 0.31
56 0.26
57 0.22
58 0.21
59 0.17
60 0.13
61 0.11
62 0.1
63 0.08
64 0.08
65 0.11
66 0.11
67 0.14
68 0.14
69 0.14
70 0.13
71 0.14
72 0.14
73 0.12
74 0.13
75 0.11
76 0.12
77 0.12
78 0.13
79 0.16
80 0.17
81 0.21
82 0.24
83 0.27
84 0.29
85 0.3
86 0.31
87 0.29
88 0.3
89 0.27
90 0.27
91 0.24
92 0.21
93 0.2
94 0.18
95 0.2
96 0.2
97 0.22
98 0.27
99 0.3
100 0.32
101 0.36
102 0.36
103 0.35
104 0.34
105 0.33
106 0.3
107 0.33
108 0.34
109 0.33
110 0.32
111 0.31
112 0.29
113 0.26
114 0.22
115 0.17
116 0.13
117 0.1
118 0.11
119 0.13
120 0.14
121 0.13
122 0.11
123 0.11
124 0.1
125 0.11
126 0.19
127 0.2
128 0.25
129 0.31
130 0.4
131 0.43
132 0.46
133 0.46
134 0.41
135 0.41
136 0.43
137 0.43
138 0.46
139 0.51
140 0.51
141 0.59
142 0.61
143 0.67
144 0.68
145 0.68
146 0.65
147 0.67
148 0.72
149 0.69