Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167JDI1

Protein Details
Accession A0A167JDI1    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
157-212YTNFTSRKRAANKSQAKKKSDNARNRRSSREKEHLKRRKTAYQSNKHCKNRSISHMHydrophilic
NLS Segment(s)
PositionSequence
163-195RKRAANKSQAKKKSDNARNRRSSREKEHLKRRK
Subcellular Location(s) nucl 19.5, cyto_nucl 13, mito 4
Family & Domain DBs
Amino Acid Sequences MSNQNESYLTRRTPAEREMTNSLAILHRDMTTVMKDVADIKAKTSNTPVSAVLQSQPMALVHAVAPVSMEMNVAGSPTMASDAKSVNKTKAYVCIIHIFKSNHLAEIQANNGKPRWNTAVNFNQSPNTELTENLVAYLERNLVGAGLRKSDVCDFVYTNFTSRKRAANKSQAKKKSDNARNRRSSREKEHLKRRKTAYQSNKHCKNRSISHM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.42
3 0.38
4 0.43
5 0.45
6 0.43
7 0.4
8 0.35
9 0.31
10 0.26
11 0.24
12 0.2
13 0.16
14 0.14
15 0.14
16 0.15
17 0.15
18 0.14
19 0.15
20 0.14
21 0.13
22 0.13
23 0.14
24 0.17
25 0.22
26 0.2
27 0.2
28 0.26
29 0.26
30 0.27
31 0.3
32 0.3
33 0.25
34 0.27
35 0.26
36 0.23
37 0.24
38 0.23
39 0.2
40 0.17
41 0.16
42 0.14
43 0.13
44 0.1
45 0.1
46 0.09
47 0.08
48 0.06
49 0.08
50 0.08
51 0.07
52 0.07
53 0.06
54 0.06
55 0.05
56 0.05
57 0.04
58 0.04
59 0.05
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.06
66 0.05
67 0.06
68 0.07
69 0.09
70 0.12
71 0.16
72 0.18
73 0.19
74 0.2
75 0.21
76 0.21
77 0.25
78 0.25
79 0.23
80 0.23
81 0.28
82 0.27
83 0.26
84 0.31
85 0.25
86 0.23
87 0.28
88 0.26
89 0.19
90 0.18
91 0.18
92 0.14
93 0.15
94 0.16
95 0.13
96 0.13
97 0.13
98 0.14
99 0.16
100 0.15
101 0.17
102 0.19
103 0.2
104 0.21
105 0.27
106 0.35
107 0.36
108 0.38
109 0.35
110 0.33
111 0.3
112 0.31
113 0.24
114 0.18
115 0.15
116 0.13
117 0.15
118 0.14
119 0.13
120 0.12
121 0.11
122 0.08
123 0.09
124 0.1
125 0.08
126 0.06
127 0.06
128 0.06
129 0.06
130 0.07
131 0.1
132 0.1
133 0.11
134 0.12
135 0.12
136 0.14
137 0.15
138 0.17
139 0.14
140 0.16
141 0.15
142 0.16
143 0.2
144 0.19
145 0.2
146 0.24
147 0.24
148 0.27
149 0.29
150 0.36
151 0.39
152 0.47
153 0.54
154 0.59
155 0.68
156 0.74
157 0.81
158 0.81
159 0.81
160 0.78
161 0.77
162 0.78
163 0.77
164 0.77
165 0.78
166 0.8
167 0.84
168 0.83
169 0.85
170 0.83
171 0.82
172 0.81
173 0.81
174 0.82
175 0.81
176 0.88
177 0.87
178 0.85
179 0.85
180 0.83
181 0.82
182 0.8
183 0.8
184 0.8
185 0.81
186 0.85
187 0.87
188 0.9
189 0.9
190 0.88
191 0.84
192 0.82