Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167JA28

Protein Details
Accession A0A167JA28   
Localization Confidence High
Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
6-35SKTKRTSKVVDDGKKRRTKKDPSAPKRGLSBasic
NLS Segment(s)
PositionSequence
17-32DGKKRRTKKDPSAPKR
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKESSKTKRTSKVVDDGKKRRTKKDPSAPKRGLSAYMFFSQDQRHVVKENNPDASFGQIGKILGERWKKMTDADKKPYNQKAELDKKRYEDEKAIAAEKHSDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.75
3 0.77
4 0.76
5 0.79
6 0.8
7 0.78
8 0.77
9 0.77
10 0.78
11 0.78
12 0.8
13 0.82
14 0.81
15 0.88
16 0.82
17 0.74
18 0.68
19 0.58
20 0.51
21 0.41
22 0.35
23 0.28
24 0.26
25 0.25
26 0.21
27 0.22
28 0.19
29 0.19
30 0.19
31 0.17
32 0.16
33 0.16
34 0.19
35 0.23
36 0.29
37 0.31
38 0.32
39 0.31
40 0.31
41 0.29
42 0.29
43 0.23
44 0.16
45 0.12
46 0.09
47 0.09
48 0.08
49 0.09
50 0.08
51 0.13
52 0.17
53 0.18
54 0.2
55 0.22
56 0.22
57 0.25
58 0.34
59 0.38
60 0.43
61 0.5
62 0.54
63 0.57
64 0.65
65 0.69
66 0.65
67 0.58
68 0.55
69 0.58
70 0.61
71 0.67
72 0.65
73 0.62
74 0.61
75 0.64
76 0.62
77 0.56
78 0.51
79 0.44
80 0.44
81 0.43
82 0.42
83 0.36
84 0.34
85 0.34