Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A162PH86

Protein Details
Accession A0A162PH86    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
53-77FCNYCSKSFKRPQDLKKHEKIHNEEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 11, cyto 6, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences EQLYNHLTNDHVGRKSTGNLCLTCHWFKCDVSVVKRDHITSHLRVHVPLKPHFCNYCSKSFKRPQDLKKHEKIHNEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.33
3 0.34
4 0.34
5 0.32
6 0.31
7 0.32
8 0.34
9 0.37
10 0.35
11 0.32
12 0.29
13 0.27
14 0.26
15 0.26
16 0.29
17 0.28
18 0.29
19 0.35
20 0.34
21 0.34
22 0.36
23 0.33
24 0.27
25 0.26
26 0.26
27 0.23
28 0.25
29 0.27
30 0.26
31 0.27
32 0.28
33 0.27
34 0.28
35 0.3
36 0.32
37 0.31
38 0.35
39 0.36
40 0.35
41 0.42
42 0.41
43 0.46
44 0.47
45 0.48
46 0.53
47 0.61
48 0.69
49 0.7
50 0.76
51 0.75
52 0.8
53 0.86
54 0.86
55 0.87
56 0.86
57 0.82