Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I2H1P9

Protein Details
Accession I2H1P9    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
44-69AKKAPAKATTNKKKTDKKASNDKVLMHydrophilic
NLS Segment(s)
PositionSequence
40-61PIPAAKKAPAKATTNKKKTDKK
216-236LARVKGGTATGGAGKKKTKTK
Subcellular Location(s) nucl 13.5, cyto_nucl 11, cyto 7.5, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR023194  eIF3-like_dom_sf  
IPR013906  eIF3j  
Gene Ontology GO:0016282  C:eukaryotic 43S preinitiation complex  
GO:0033290  C:eukaryotic 48S preinitiation complex  
GO:0005852  C:eukaryotic translation initiation factor 3 complex  
GO:0003743  F:translation initiation factor activity  
GO:0001732  P:formation of cytoplasmic translation initiation complex  
KEGG tbl:TBLA_0C05050  -  
Pfam View protein in Pfam  
PF08597  eIF3_subunit  
Amino Acid Sequences MFNGATDAGADDAVLMDSWDADEQLMESWDAEEKPVGTKPIPAAKKAPAKATTNKKKTDKKASNDKVLMEIDTLDEKTRKELLKKAELESDLNNAADLFAGLGVAEEHPKAKLLRREQEESLLMQRASLTKDTPIENHPLFVQAETKTDYQELRKALGVAVTSMNEKSSLNYTSSLAIDLIRDVAKPLSIESIRQTVATLNALIKEKERQERQSRLARVKGGTATGGAGKKKTKTKVNLGGAFKKNEDLDMSNMDDFDFGDDDFM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.04
4 0.04
5 0.05
6 0.06
7 0.06
8 0.05
9 0.05
10 0.06
11 0.07
12 0.08
13 0.07
14 0.07
15 0.08
16 0.1
17 0.11
18 0.11
19 0.11
20 0.11
21 0.14
22 0.16
23 0.19
24 0.16
25 0.2
26 0.24
27 0.33
28 0.35
29 0.35
30 0.36
31 0.41
32 0.5
33 0.49
34 0.51
35 0.48
36 0.51
37 0.57
38 0.64
39 0.67
40 0.66
41 0.72
42 0.74
43 0.78
44 0.82
45 0.84
46 0.83
47 0.81
48 0.84
49 0.83
50 0.83
51 0.76
52 0.67
53 0.6
54 0.51
55 0.43
56 0.31
57 0.24
58 0.15
59 0.14
60 0.14
61 0.12
62 0.12
63 0.12
64 0.15
65 0.2
66 0.22
67 0.24
68 0.3
69 0.35
70 0.42
71 0.45
72 0.44
73 0.44
74 0.42
75 0.4
76 0.35
77 0.3
78 0.22
79 0.19
80 0.17
81 0.12
82 0.1
83 0.08
84 0.07
85 0.04
86 0.03
87 0.03
88 0.02
89 0.03
90 0.03
91 0.03
92 0.04
93 0.04
94 0.05
95 0.05
96 0.07
97 0.08
98 0.13
99 0.2
100 0.27
101 0.35
102 0.4
103 0.44
104 0.43
105 0.46
106 0.41
107 0.35
108 0.31
109 0.25
110 0.19
111 0.15
112 0.14
113 0.12
114 0.13
115 0.12
116 0.1
117 0.1
118 0.12
119 0.13
120 0.14
121 0.15
122 0.18
123 0.18
124 0.18
125 0.16
126 0.16
127 0.16
128 0.14
129 0.15
130 0.1
131 0.11
132 0.14
133 0.14
134 0.12
135 0.14
136 0.15
137 0.14
138 0.18
139 0.17
140 0.16
141 0.16
142 0.16
143 0.15
144 0.15
145 0.13
146 0.1
147 0.1
148 0.09
149 0.09
150 0.09
151 0.09
152 0.08
153 0.08
154 0.08
155 0.1
156 0.11
157 0.12
158 0.13
159 0.13
160 0.14
161 0.14
162 0.14
163 0.11
164 0.1
165 0.09
166 0.08
167 0.08
168 0.07
169 0.07
170 0.07
171 0.07
172 0.08
173 0.08
174 0.08
175 0.13
176 0.13
177 0.14
178 0.16
179 0.19
180 0.18
181 0.18
182 0.18
183 0.13
184 0.15
185 0.15
186 0.13
187 0.11
188 0.13
189 0.15
190 0.15
191 0.16
192 0.2
193 0.25
194 0.33
195 0.39
196 0.45
197 0.52
198 0.6
199 0.66
200 0.7
201 0.71
202 0.7
203 0.69
204 0.65
205 0.57
206 0.53
207 0.47
208 0.39
209 0.31
210 0.24
211 0.2
212 0.2
213 0.22
214 0.2
215 0.22
216 0.26
217 0.32
218 0.39
219 0.46
220 0.5
221 0.55
222 0.64
223 0.7
224 0.76
225 0.78
226 0.77
227 0.79
228 0.75
229 0.7
230 0.61
231 0.54
232 0.45
233 0.38
234 0.35
235 0.28
236 0.26
237 0.26
238 0.28
239 0.25
240 0.24
241 0.23
242 0.19
243 0.16
244 0.15
245 0.12