Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162ZF60

Protein Details
Accession A0A162ZF60    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
143-169EVWAEHQVTKRKKKLWRKKDETIGQLFHydrophilic
NLS Segment(s)
PositionSequence
152-161KRKKKLWRKK
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR009446  Mgm101  
Gene Ontology GO:0000262  C:mitochondrial chromosome  
GO:0003697  F:single-stranded DNA binding  
GO:0006281  P:DNA repair  
GO:0000002  P:mitochondrial genome maintenance  
Pfam View protein in Pfam  
PF06420  Mgm101p  
Amino Acid Sequences NWSTSFHGLSTQPFSSEISNLLMQPINESDIEVKPDGMIYLPEIKYRRILNIAFGPGGWGLAPRGEHSISPKNVSREYALVCHGRFVSQARGEQDYFDVSGLPTASEGCKSNALMRCCKDLGIASELWDPSYIRKFKKKHCVEVWAEHQVTKRKKKLWRKKDETIGQLFELNVFFPILYFSVITNINTRNQIKFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.22
3 0.21
4 0.19
5 0.17
6 0.17
7 0.16
8 0.18
9 0.17
10 0.16
11 0.17
12 0.16
13 0.15
14 0.13
15 0.14
16 0.15
17 0.15
18 0.18
19 0.16
20 0.15
21 0.13
22 0.14
23 0.13
24 0.1
25 0.09
26 0.08
27 0.15
28 0.16
29 0.2
30 0.22
31 0.23
32 0.27
33 0.28
34 0.29
35 0.26
36 0.26
37 0.27
38 0.3
39 0.31
40 0.26
41 0.24
42 0.22
43 0.17
44 0.17
45 0.11
46 0.07
47 0.05
48 0.07
49 0.07
50 0.07
51 0.1
52 0.11
53 0.11
54 0.17
55 0.24
56 0.24
57 0.28
58 0.31
59 0.31
60 0.32
61 0.32
62 0.28
63 0.23
64 0.23
65 0.21
66 0.2
67 0.2
68 0.19
69 0.19
70 0.17
71 0.15
72 0.14
73 0.14
74 0.17
75 0.16
76 0.19
77 0.19
78 0.22
79 0.22
80 0.21
81 0.2
82 0.15
83 0.13
84 0.1
85 0.08
86 0.05
87 0.06
88 0.06
89 0.05
90 0.04
91 0.04
92 0.05
93 0.06
94 0.07
95 0.08
96 0.09
97 0.1
98 0.16
99 0.21
100 0.23
101 0.28
102 0.28
103 0.31
104 0.3
105 0.29
106 0.24
107 0.2
108 0.2
109 0.18
110 0.16
111 0.14
112 0.16
113 0.16
114 0.16
115 0.15
116 0.12
117 0.12
118 0.2
119 0.23
120 0.26
121 0.35
122 0.41
123 0.5
124 0.61
125 0.66
126 0.68
127 0.69
128 0.74
129 0.7
130 0.72
131 0.69
132 0.66
133 0.58
134 0.5
135 0.49
136 0.49
137 0.52
138 0.54
139 0.56
140 0.55
141 0.65
142 0.74
143 0.81
144 0.83
145 0.85
146 0.85
147 0.87
148 0.9
149 0.88
150 0.84
151 0.79
152 0.71
153 0.6
154 0.53
155 0.43
156 0.34
157 0.26
158 0.18
159 0.13
160 0.1
161 0.08
162 0.07
163 0.08
164 0.08
165 0.08
166 0.09
167 0.08
168 0.12
169 0.13
170 0.15
171 0.18
172 0.19
173 0.23
174 0.3
175 0.32