Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A162NKL6

Protein Details
Accession A0A162NKL6    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MSKSKNHTNHNQNKKAHRNGLKKPSQMHydrophilic
NLS Segment(s)
PositionSequence
22-22K
Subcellular Location(s) nucl 23.5, cyto_nucl 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MSKSKNHTNHNQNKKAHRNGLKKPSQMKYPSLKGVDAKFLRNQRHARKGTEKALALKYASKTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.83
3 0.82
4 0.81
5 0.79
6 0.8
7 0.83
8 0.8
9 0.76
10 0.76
11 0.7
12 0.67
13 0.62
14 0.58
15 0.54
16 0.51
17 0.49
18 0.43
19 0.4
20 0.35
21 0.33
22 0.35
23 0.29
24 0.28
25 0.29
26 0.34
27 0.38
28 0.43
29 0.51
30 0.52
31 0.6
32 0.62
33 0.64
34 0.66
35 0.69
36 0.67
37 0.66
38 0.6
39 0.56
40 0.55
41 0.5
42 0.43
43 0.41