Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A163ADR7

Protein Details
Accession A0A163ADR7    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MEKRGRDSKRKDRRRDEYSRNTVKPFBasic
NLS Segment(s)
PositionSequence
4-15RGRDSKRKDRRR
Subcellular Location(s) plas 12, nucl 8.5, cyto_nucl 5.5, mito 2, cyto 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
IPR039177  SMG9  
Gene Ontology GO:0000184  P:nuclear-transcribed mRNA catabolic process, nonsense-mediated decay  
Amino Acid Sequences MEKRGRDSKRKDRRRDEYSRNTVKPFMQAPVILERPNRIEPTQSEPVDDRKQCDQPRPAKPEEIKAVLPFFRRQTKFQIDTVLKCLGDHPGHFVVGVVGKQGVGKSTLLSSLMQDTTEGFATQNTDILAYEGHKTLGIDMHITSERTILLDTEPILSWSVMDRALRTGGLEGLPPDIWIEMESLYQLVFMLSVCNVVMFVSEGSEVDSLILQSLRRAEMLKVNLPEFPLIPLSSLTQDPHYVADIVFVGNKCQDLEFTWRHYRNAQTVLKSALAGSSLKISGLVSLGYVLPAFDIPDPINLFFLPTTNPASGVESFDILMASLRDQVMAAPRRAGKRGQVSEKEWFRNSVKTYELIRKSDHFMDYLKMAKKFRDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.92
3 0.92
4 0.91
5 0.91
6 0.91
7 0.85
8 0.78
9 0.73
10 0.64
11 0.6
12 0.52
13 0.44
14 0.37
15 0.33
16 0.32
17 0.35
18 0.36
19 0.32
20 0.31
21 0.31
22 0.34
23 0.37
24 0.38
25 0.31
26 0.34
27 0.34
28 0.41
29 0.47
30 0.41
31 0.4
32 0.38
33 0.45
34 0.49
35 0.48
36 0.44
37 0.42
38 0.5
39 0.53
40 0.6
41 0.62
42 0.62
43 0.7
44 0.73
45 0.7
46 0.71
47 0.69
48 0.68
49 0.65
50 0.59
51 0.51
52 0.46
53 0.45
54 0.4
55 0.39
56 0.35
57 0.34
58 0.4
59 0.41
60 0.42
61 0.48
62 0.54
63 0.54
64 0.52
65 0.56
66 0.5
67 0.49
68 0.5
69 0.44
70 0.34
71 0.3
72 0.29
73 0.26
74 0.24
75 0.22
76 0.23
77 0.21
78 0.21
79 0.21
80 0.2
81 0.15
82 0.14
83 0.14
84 0.09
85 0.07
86 0.08
87 0.08
88 0.08
89 0.08
90 0.08
91 0.08
92 0.08
93 0.09
94 0.1
95 0.1
96 0.1
97 0.1
98 0.12
99 0.12
100 0.11
101 0.1
102 0.1
103 0.11
104 0.11
105 0.1
106 0.07
107 0.07
108 0.1
109 0.1
110 0.1
111 0.08
112 0.08
113 0.08
114 0.08
115 0.08
116 0.07
117 0.09
118 0.08
119 0.08
120 0.08
121 0.08
122 0.09
123 0.1
124 0.09
125 0.08
126 0.08
127 0.11
128 0.11
129 0.12
130 0.11
131 0.1
132 0.1
133 0.09
134 0.09
135 0.07
136 0.06
137 0.07
138 0.07
139 0.08
140 0.08
141 0.08
142 0.09
143 0.08
144 0.08
145 0.07
146 0.08
147 0.08
148 0.08
149 0.08
150 0.08
151 0.09
152 0.09
153 0.08
154 0.08
155 0.07
156 0.07
157 0.07
158 0.06
159 0.07
160 0.07
161 0.07
162 0.06
163 0.05
164 0.05
165 0.05
166 0.05
167 0.05
168 0.05
169 0.05
170 0.05
171 0.04
172 0.04
173 0.04
174 0.03
175 0.03
176 0.03
177 0.03
178 0.03
179 0.03
180 0.03
181 0.03
182 0.03
183 0.03
184 0.03
185 0.03
186 0.03
187 0.04
188 0.04
189 0.04
190 0.05
191 0.05
192 0.05
193 0.05
194 0.05
195 0.04
196 0.05
197 0.06
198 0.04
199 0.05
200 0.07
201 0.07
202 0.08
203 0.09
204 0.1
205 0.14
206 0.18
207 0.21
208 0.22
209 0.22
210 0.22
211 0.21
212 0.21
213 0.16
214 0.14
215 0.11
216 0.09
217 0.09
218 0.09
219 0.09
220 0.1
221 0.11
222 0.11
223 0.11
224 0.11
225 0.11
226 0.11
227 0.11
228 0.1
229 0.09
230 0.09
231 0.08
232 0.08
233 0.1
234 0.09
235 0.09
236 0.09
237 0.1
238 0.09
239 0.09
240 0.09
241 0.09
242 0.16
243 0.18
244 0.24
245 0.33
246 0.35
247 0.37
248 0.4
249 0.42
250 0.4
251 0.47
252 0.44
253 0.38
254 0.38
255 0.39
256 0.36
257 0.31
258 0.26
259 0.17
260 0.14
261 0.11
262 0.09
263 0.09
264 0.09
265 0.09
266 0.09
267 0.09
268 0.08
269 0.08
270 0.07
271 0.05
272 0.06
273 0.06
274 0.06
275 0.06
276 0.05
277 0.05
278 0.05
279 0.06
280 0.06
281 0.08
282 0.08
283 0.12
284 0.14
285 0.14
286 0.15
287 0.14
288 0.15
289 0.13
290 0.13
291 0.11
292 0.12
293 0.16
294 0.15
295 0.16
296 0.16
297 0.19
298 0.19
299 0.2
300 0.18
301 0.15
302 0.15
303 0.14
304 0.13
305 0.1
306 0.1
307 0.07
308 0.07
309 0.09
310 0.09
311 0.09
312 0.09
313 0.11
314 0.19
315 0.24
316 0.24
317 0.27
318 0.33
319 0.37
320 0.4
321 0.42
322 0.41
323 0.46
324 0.54
325 0.59
326 0.61
327 0.61
328 0.68
329 0.73
330 0.71
331 0.63
332 0.59
333 0.52
334 0.53
335 0.52
336 0.46
337 0.41
338 0.39
339 0.43
340 0.47
341 0.51
342 0.47
343 0.47
344 0.47
345 0.5
346 0.51
347 0.46
348 0.38
349 0.34
350 0.33
351 0.33
352 0.37
353 0.37
354 0.37
355 0.38