Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162XE20

Protein Details
Accession A0A162XE20    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
68-95RLIIKCRTCHEKPKKPKAVIKKKYYAITHydrophilic
NLS Segment(s)
PositionSequence
80-89PKKPKAVIKK
Subcellular Location(s) nucl 10, cyto_nucl 9.5, mito 9, cyto 7
Family & Domain DBs
Amino Acid Sequences MYTTAIFCTMNLNINLIDFGFSHGSKEACACVKMSSCGHYNLVLAPDNTCNCSKNTSVIFPNGTCPNRLIIKCRTCHEKPKKPKAVIKKKYYAITTVEYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.13
4 0.13
5 0.08
6 0.1
7 0.11
8 0.11
9 0.12
10 0.14
11 0.14
12 0.13
13 0.14
14 0.14
15 0.13
16 0.14
17 0.13
18 0.13
19 0.14
20 0.17
21 0.17
22 0.18
23 0.18
24 0.19
25 0.19
26 0.18
27 0.17
28 0.15
29 0.16
30 0.14
31 0.12
32 0.11
33 0.12
34 0.12
35 0.14
36 0.14
37 0.13
38 0.12
39 0.15
40 0.14
41 0.16
42 0.18
43 0.19
44 0.2
45 0.22
46 0.23
47 0.2
48 0.24
49 0.26
50 0.25
51 0.23
52 0.22
53 0.23
54 0.27
55 0.28
56 0.29
57 0.32
58 0.38
59 0.41
60 0.45
61 0.49
62 0.48
63 0.58
64 0.64
65 0.66
66 0.7
67 0.78
68 0.84
69 0.84
70 0.88
71 0.88
72 0.89
73 0.88
74 0.86
75 0.84
76 0.8
77 0.79
78 0.72
79 0.65
80 0.58