Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0W3V3

Protein Details
Accession G0W3V3   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
50-72QLTENSKKVRKSKNEKRKIIDTAHydrophilic
NLS Segment(s)
PositionSequence
56-67KKVRKSKNEKRK
Subcellular Location(s) nucl 16, cyto 7, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013895  Rsc14  
Gene Ontology GO:0016586  C:RSC-type complex  
GO:0006338  P:chromatin remodeling  
KEGG ndi:NDAI_0A03340  -  
Pfam View protein in Pfam  
PF08586  Rsc14  
Amino Acid Sequences MNQQVQNSITPSSLPVEKNTITNSYYDVISGLAALERSHQITFSQDELLQLTENSKKVRKSKNEKRKIIDTAVRPTIHSYLGGTINVTDKTNYDVSHTLLGNHVPKSQLETLSSIDFAQLFHKYLSCEDVLQIHDIFFSNSFPNTFSSPPVDIHNEDTNKEGEKAKVRKVIICKRCNSRFTGRNRMSLLKKHTCNNRRRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.26
4 0.26
5 0.29
6 0.3
7 0.3
8 0.26
9 0.25
10 0.25
11 0.2
12 0.19
13 0.17
14 0.14
15 0.11
16 0.1
17 0.09
18 0.07
19 0.05
20 0.06
21 0.06
22 0.07
23 0.09
24 0.11
25 0.11
26 0.11
27 0.11
28 0.14
29 0.16
30 0.16
31 0.16
32 0.15
33 0.15
34 0.16
35 0.16
36 0.13
37 0.11
38 0.12
39 0.14
40 0.16
41 0.19
42 0.22
43 0.28
44 0.36
45 0.46
46 0.54
47 0.61
48 0.7
49 0.78
50 0.84
51 0.86
52 0.84
53 0.82
54 0.76
55 0.72
56 0.67
57 0.61
58 0.57
59 0.54
60 0.48
61 0.41
62 0.38
63 0.32
64 0.26
65 0.21
66 0.15
67 0.12
68 0.12
69 0.12
70 0.1
71 0.09
72 0.11
73 0.11
74 0.11
75 0.08
76 0.08
77 0.11
78 0.12
79 0.11
80 0.12
81 0.13
82 0.13
83 0.16
84 0.16
85 0.13
86 0.13
87 0.15
88 0.14
89 0.14
90 0.14
91 0.11
92 0.11
93 0.15
94 0.17
95 0.16
96 0.14
97 0.15
98 0.16
99 0.16
100 0.16
101 0.12
102 0.1
103 0.09
104 0.08
105 0.08
106 0.08
107 0.09
108 0.09
109 0.1
110 0.1
111 0.11
112 0.13
113 0.11
114 0.11
115 0.1
116 0.12
117 0.12
118 0.13
119 0.13
120 0.1
121 0.1
122 0.1
123 0.1
124 0.08
125 0.09
126 0.08
127 0.09
128 0.09
129 0.1
130 0.12
131 0.14
132 0.14
133 0.15
134 0.17
135 0.19
136 0.19
137 0.22
138 0.24
139 0.22
140 0.27
141 0.32
142 0.3
143 0.29
144 0.3
145 0.28
146 0.25
147 0.26
148 0.24
149 0.21
150 0.3
151 0.35
152 0.4
153 0.45
154 0.45
155 0.49
156 0.57
157 0.63
158 0.63
159 0.66
160 0.66
161 0.69
162 0.76
163 0.73
164 0.7
165 0.7
166 0.67
167 0.68
168 0.72
169 0.66
170 0.65
171 0.67
172 0.68
173 0.65
174 0.65
175 0.66
176 0.65
177 0.65
178 0.66
179 0.73
180 0.74