Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165E9L9

Protein Details
Accession A0A165E9L9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
36-55LMTKSKVKPYPKKTNHPAKEHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_mito 11.833, mito 11.5, cyto 11, cyto_nucl 7.833
Family & Domain DBs
Amino Acid Sequences LGHPNMAAVASLARSGAIPGVSVDDSKPLPICEHCLMTKSKVKPYPKKTNHPAKEVLEVVGVDLTGPMSSTSISGSRYGLIHYDNKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.07
4 0.06
5 0.06
6 0.06
7 0.09
8 0.09
9 0.09
10 0.09
11 0.11
12 0.11
13 0.11
14 0.12
15 0.1
16 0.12
17 0.12
18 0.17
19 0.16
20 0.19
21 0.18
22 0.2
23 0.21
24 0.24
25 0.3
26 0.27
27 0.32
28 0.37
29 0.45
30 0.52
31 0.6
32 0.67
33 0.68
34 0.75
35 0.77
36 0.82
37 0.78
38 0.74
39 0.7
40 0.61
41 0.58
42 0.49
43 0.4
44 0.29
45 0.24
46 0.19
47 0.13
48 0.1
49 0.06
50 0.05
51 0.04
52 0.03
53 0.04
54 0.04
55 0.04
56 0.05
57 0.05
58 0.07
59 0.09
60 0.1
61 0.11
62 0.12
63 0.13
64 0.14
65 0.14
66 0.15
67 0.17