Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165DK62

Protein Details
Accession A0A165DK62    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
16-40ARAVAFRPRRLRCRARARCPARSAPHydrophilic
130-152SHDPPCRPTRPVRRVPGRCPVRPBasic
NLS Segment(s)
PositionSequence
103-122TRSRAARSARNRVRRARASR
Subcellular Location(s) mito 26
Family & Domain DBs
Amino Acid Sequences CPRPPRSFQPTAPLAARAVAFRPRRLRCRARARCPARSAPLPPTPASPAAHATVCSTPARPVLILDQKIPTRRLAARHVVSRPCRVCARVRAAGIARSALPATRSRAARSARNRVRRARASRINFGIRNSHDPPCRPTRPVRRVPGRCPVRPHSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.31
3 0.29
4 0.21
5 0.2
6 0.24
7 0.26
8 0.32
9 0.41
10 0.47
11 0.54
12 0.62
13 0.69
14 0.71
15 0.79
16 0.82
17 0.82
18 0.86
19 0.85
20 0.85
21 0.82
22 0.78
23 0.73
24 0.68
25 0.62
26 0.58
27 0.56
28 0.5
29 0.44
30 0.4
31 0.36
32 0.34
33 0.31
34 0.26
35 0.22
36 0.21
37 0.2
38 0.18
39 0.17
40 0.15
41 0.16
42 0.15
43 0.13
44 0.13
45 0.13
46 0.14
47 0.12
48 0.12
49 0.15
50 0.21
51 0.21
52 0.21
53 0.23
54 0.24
55 0.27
56 0.28
57 0.23
58 0.21
59 0.22
60 0.25
61 0.27
62 0.32
63 0.32
64 0.35
65 0.38
66 0.4
67 0.41
68 0.44
69 0.4
70 0.36
71 0.35
72 0.33
73 0.34
74 0.35
75 0.39
76 0.36
77 0.35
78 0.35
79 0.35
80 0.34
81 0.3
82 0.24
83 0.17
84 0.13
85 0.13
86 0.1
87 0.11
88 0.11
89 0.15
90 0.2
91 0.21
92 0.23
93 0.29
94 0.33
95 0.39
96 0.45
97 0.52
98 0.55
99 0.64
100 0.69
101 0.71
102 0.77
103 0.78
104 0.78
105 0.77
106 0.78
107 0.74
108 0.75
109 0.73
110 0.71
111 0.64
112 0.58
113 0.56
114 0.5
115 0.5
116 0.47
117 0.47
118 0.45
119 0.46
120 0.51
121 0.52
122 0.54
123 0.52
124 0.58
125 0.62
126 0.67
127 0.74
128 0.78
129 0.79
130 0.83
131 0.85
132 0.85
133 0.82
134 0.78
135 0.77