Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165GU23

Protein Details
Accession A0A165GU23    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
80-107CPRVLRARVRHQRPTRRLQRQRLPLDPHHydrophilic
NLS Segment(s)
PositionSequence
51-99GSLRRARIRRTFPARSRGSARPASRRRFLCPRVLRARVRHQRPTRRLQR
Subcellular Location(s) nucl 19, cyto_nucl 11.5, mito 6
Family & Domain DBs
Amino Acid Sequences MQPTSSRQRPSPDATAAVAARRQRAEIRLSRTSRSPRPALRAPGCPCQRPGSLRRARIRRTFPARSRGSARPASRRRFLCPRVLRARVRHQRPTRRLQRQRLPLDPHRRAWESCQPSLLLSLAPNQPRSSAMTTKFHFPARRVQLVGVAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.44
3 0.37
4 0.33
5 0.3
6 0.26
7 0.27
8 0.25
9 0.26
10 0.26
11 0.29
12 0.35
13 0.38
14 0.43
15 0.48
16 0.5
17 0.5
18 0.54
19 0.58
20 0.57
21 0.57
22 0.57
23 0.53
24 0.58
25 0.62
26 0.64
27 0.6
28 0.61
29 0.59
30 0.61
31 0.6
32 0.55
33 0.5
34 0.46
35 0.45
36 0.41
37 0.42
38 0.43
39 0.46
40 0.52
41 0.58
42 0.62
43 0.65
44 0.68
45 0.69
46 0.68
47 0.69
48 0.7
49 0.67
50 0.68
51 0.65
52 0.6
53 0.59
54 0.53
55 0.51
56 0.48
57 0.46
58 0.47
59 0.52
60 0.54
61 0.55
62 0.53
63 0.53
64 0.55
65 0.55
66 0.55
67 0.52
68 0.55
69 0.56
70 0.61
71 0.6
72 0.58
73 0.65
74 0.65
75 0.66
76 0.68
77 0.69
78 0.73
79 0.76
80 0.8
81 0.8
82 0.82
83 0.85
84 0.84
85 0.84
86 0.84
87 0.83
88 0.81
89 0.78
90 0.76
91 0.77
92 0.73
93 0.68
94 0.64
95 0.61
96 0.54
97 0.53
98 0.53
99 0.49
100 0.45
101 0.42
102 0.36
103 0.33
104 0.33
105 0.27
106 0.17
107 0.11
108 0.15
109 0.19
110 0.22
111 0.24
112 0.23
113 0.23
114 0.24
115 0.28
116 0.29
117 0.3
118 0.32
119 0.38
120 0.4
121 0.45
122 0.47
123 0.49
124 0.48
125 0.44
126 0.49
127 0.49
128 0.54
129 0.49
130 0.46