Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166AIH8

Protein Details
Accession A0A166AIH8    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
249-281AKPPVRTPTKPPVRKPTKPPVRKPTRPPVRTPAHydrophilic
286-339RTPTKPTRPVTRPPVTRKPVTRKPVTRKPVTRKPVTRKPTKPVRPTRPRKGGRHBasic
NLS Segment(s)
PositionSequence
249-339AKPPVRTPTKPPVRKPTKPPVRKPTRPPVRTPAKPPVRTPTKPTRPVTRPPVTRKPVTRKPVTRKPVTRKPVTRKPTKPVRPTRPRKGGRH
Subcellular Location(s) extr 16, mito 5, plas 3, cyto 2
Family & Domain DBs
Amino Acid Sequences MRSFTTTAAAFFAFAAVQVVAGPLSDFGGLLGLRSDSYVNEYHESFVPQNASLASRALPADIYKQVDTAIAAQGHKVHFFWTGSVPPAKGTADFVGPIARTLSKKFNGVTIDEALSHLPMPGFGQMTSADIALWRYASLRWAETSAGEVYVVYGGVVRHGNTFETELPALKKNRNVKKVWRIDSPTRGHTGQRKQIWPADPCAAGKPKTSRLRRAYEIAVRAVTGKTPAPPAHGAGAACPMPQKPTTPAKPPVRTPTKPPVRKPTKPPVRKPTRPPVRTPAKPPVRTPTKPTRPVTRPPVTRKPVTRKPVTRKPVTRKPVTRKPTKPVRPTRPRKGGRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.07
4 0.06
5 0.06
6 0.06
7 0.06
8 0.06
9 0.06
10 0.05
11 0.05
12 0.05
13 0.05
14 0.05
15 0.07
16 0.07
17 0.07
18 0.08
19 0.07
20 0.07
21 0.08
22 0.09
23 0.07
24 0.12
25 0.15
26 0.17
27 0.19
28 0.2
29 0.21
30 0.22
31 0.26
32 0.22
33 0.22
34 0.21
35 0.19
36 0.19
37 0.18
38 0.18
39 0.15
40 0.15
41 0.13
42 0.13
43 0.13
44 0.12
45 0.12
46 0.11
47 0.15
48 0.18
49 0.2
50 0.18
51 0.19
52 0.18
53 0.18
54 0.18
55 0.15
56 0.15
57 0.14
58 0.14
59 0.14
60 0.18
61 0.18
62 0.18
63 0.17
64 0.14
65 0.15
66 0.15
67 0.16
68 0.16
69 0.17
70 0.19
71 0.22
72 0.21
73 0.18
74 0.19
75 0.18
76 0.16
77 0.16
78 0.14
79 0.13
80 0.13
81 0.13
82 0.13
83 0.12
84 0.12
85 0.11
86 0.12
87 0.13
88 0.16
89 0.23
90 0.22
91 0.25
92 0.25
93 0.28
94 0.27
95 0.27
96 0.27
97 0.22
98 0.21
99 0.18
100 0.18
101 0.14
102 0.12
103 0.11
104 0.08
105 0.06
106 0.05
107 0.06
108 0.07
109 0.07
110 0.07
111 0.08
112 0.08
113 0.09
114 0.09
115 0.09
116 0.07
117 0.06
118 0.07
119 0.06
120 0.06
121 0.05
122 0.05
123 0.05
124 0.08
125 0.09
126 0.09
127 0.1
128 0.11
129 0.11
130 0.1
131 0.12
132 0.1
133 0.09
134 0.08
135 0.07
136 0.06
137 0.06
138 0.06
139 0.03
140 0.04
141 0.04
142 0.05
143 0.06
144 0.06
145 0.07
146 0.08
147 0.08
148 0.08
149 0.1
150 0.09
151 0.1
152 0.1
153 0.1
154 0.11
155 0.16
156 0.18
157 0.18
158 0.23
159 0.31
160 0.39
161 0.45
162 0.47
163 0.52
164 0.6
165 0.67
166 0.66
167 0.63
168 0.61
169 0.6
170 0.65
171 0.59
172 0.51
173 0.46
174 0.42
175 0.4
176 0.41
177 0.43
178 0.42
179 0.45
180 0.45
181 0.44
182 0.49
183 0.5
184 0.44
185 0.4
186 0.35
187 0.3
188 0.28
189 0.29
190 0.28
191 0.23
192 0.26
193 0.26
194 0.33
195 0.41
196 0.46
197 0.52
198 0.55
199 0.6
200 0.6
201 0.6
202 0.56
203 0.52
204 0.49
205 0.41
206 0.34
207 0.28
208 0.25
209 0.21
210 0.16
211 0.12
212 0.1
213 0.1
214 0.14
215 0.15
216 0.17
217 0.19
218 0.2
219 0.2
220 0.2
221 0.19
222 0.15
223 0.18
224 0.14
225 0.13
226 0.13
227 0.11
228 0.13
229 0.14
230 0.16
231 0.18
232 0.28
233 0.33
234 0.4
235 0.49
236 0.56
237 0.61
238 0.64
239 0.69
240 0.69
241 0.66
242 0.66
243 0.67
244 0.68
245 0.71
246 0.73
247 0.74
248 0.75
249 0.8
250 0.82
251 0.82
252 0.82
253 0.84
254 0.87
255 0.87
256 0.88
257 0.88
258 0.89
259 0.89
260 0.89
261 0.84
262 0.8
263 0.79
264 0.79
265 0.76
266 0.75
267 0.75
268 0.74
269 0.74
270 0.71
271 0.72
272 0.7
273 0.68
274 0.68
275 0.68
276 0.69
277 0.73
278 0.74
279 0.74
280 0.71
281 0.77
282 0.79
283 0.77
284 0.76
285 0.76
286 0.81
287 0.78
288 0.8
289 0.81
290 0.81
291 0.81
292 0.81
293 0.82
294 0.82
295 0.85
296 0.87
297 0.87
298 0.87
299 0.87
300 0.88
301 0.88
302 0.87
303 0.88
304 0.87
305 0.88
306 0.88
307 0.88
308 0.88
309 0.86
310 0.86
311 0.87
312 0.87
313 0.88
314 0.88
315 0.9
316 0.9
317 0.93
318 0.94
319 0.94