Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2H9N9

Protein Details
Accession I2H9N9    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
71-98TSVKTTCKVTKKKGNKRRKNQCYYGDCSHydrophilic
NLS Segment(s)
PositionSequence
81-89KKKGNKRRK
Subcellular Location(s) nucl 23, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR035896  AN1-like_Znf  
IPR000058  Znf_AN1  
Gene Ontology GO:0008270  F:zinc ion binding  
KEGG tbl:TBLA_0J00930  -  
Pfam View protein in Pfam  
PF01428  zf-AN1  
PROSITE View protein in PROSITE  
PS51039  ZF_AN1  
Amino Acid Sequences MSEVTRQEQVNNNNSPAATEEATTPALNQESLINTDAAPIIKQPFQINNARLILDDTITSIPNASPNLPTTSVKTTCKVTKKKGNKRRKNQCYYGDCSSTISKFIGNCKFCNKNYCSKHRLMEIHDCRGLKSCRDQMHKRNAEKLASEQTKSPKIQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.36
3 0.31
4 0.27
5 0.2
6 0.16
7 0.16
8 0.16
9 0.18
10 0.17
11 0.15
12 0.13
13 0.14
14 0.13
15 0.12
16 0.11
17 0.11
18 0.14
19 0.15
20 0.13
21 0.11
22 0.12
23 0.13
24 0.12
25 0.1
26 0.1
27 0.11
28 0.12
29 0.14
30 0.16
31 0.18
32 0.22
33 0.29
34 0.29
35 0.31
36 0.31
37 0.29
38 0.27
39 0.25
40 0.2
41 0.14
42 0.12
43 0.09
44 0.09
45 0.09
46 0.08
47 0.07
48 0.07
49 0.08
50 0.09
51 0.09
52 0.09
53 0.1
54 0.13
55 0.15
56 0.15
57 0.17
58 0.21
59 0.24
60 0.24
61 0.24
62 0.25
63 0.29
64 0.37
65 0.4
66 0.43
67 0.5
68 0.59
69 0.69
70 0.76
71 0.81
72 0.83
73 0.88
74 0.92
75 0.93
76 0.9
77 0.87
78 0.86
79 0.81
80 0.77
81 0.7
82 0.61
83 0.5
84 0.44
85 0.38
86 0.29
87 0.24
88 0.18
89 0.15
90 0.14
91 0.21
92 0.26
93 0.27
94 0.28
95 0.34
96 0.4
97 0.41
98 0.48
99 0.45
100 0.47
101 0.53
102 0.6
103 0.6
104 0.58
105 0.6
106 0.59
107 0.59
108 0.55
109 0.57
110 0.55
111 0.55
112 0.54
113 0.5
114 0.44
115 0.47
116 0.44
117 0.37
118 0.39
119 0.4
120 0.45
121 0.54
122 0.62
123 0.64
124 0.73
125 0.78
126 0.74
127 0.75
128 0.72
129 0.67
130 0.6
131 0.57
132 0.56
133 0.51
134 0.48
135 0.45
136 0.48
137 0.52