Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166A5J0

Protein Details
Accession A0A166A5J0   
Localization Confidence High
Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
47-74LRSCCPSRVVPRRGRKPKPATKFEKQSLHydrophilic
80-101LDPSSAHRRLQWRKRRSRHPTAHydrophilic
NLS Segment(s)
PositionSequence
57-99PRRGRKPKPATKFEKQSLSHSGRLDPSSAHRRLQWRKRRSRHP
Subcellular Location(s) nucl 14, mito 6, cyto 4, pero 2
Family & Domain DBs
Amino Acid Sequences MTQKDVVPFFARLVNKEMQGDRHPDVHRRCFTLAQQSSTRTGNTVCLRSCCPSRVVPRRGRKPKPATKFEKQSLSHSGRLDPSSAHRRLQWRKRRSRHPTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.27
3 0.3
4 0.31
5 0.29
6 0.32
7 0.35
8 0.32
9 0.36
10 0.37
11 0.41
12 0.46
13 0.51
14 0.5
15 0.48
16 0.49
17 0.45
18 0.45
19 0.48
20 0.44
21 0.39
22 0.38
23 0.36
24 0.37
25 0.34
26 0.31
27 0.21
28 0.19
29 0.21
30 0.21
31 0.22
32 0.2
33 0.21
34 0.23
35 0.25
36 0.26
37 0.21
38 0.21
39 0.23
40 0.32
41 0.39
42 0.46
43 0.53
44 0.61
45 0.71
46 0.79
47 0.8
48 0.81
49 0.82
50 0.83
51 0.83
52 0.83
53 0.81
54 0.79
55 0.81
56 0.76
57 0.75
58 0.67
59 0.63
60 0.62
61 0.58
62 0.54
63 0.46
64 0.44
65 0.38
66 0.37
67 0.33
68 0.25
69 0.28
70 0.33
71 0.34
72 0.34
73 0.36
74 0.45
75 0.55
76 0.64
77 0.67
78 0.69
79 0.77
80 0.85
81 0.91