Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165ED98

Protein Details
Accession A0A165ED98    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
19-49RTTLPPRAPRIARRRRARRRVVSPKVKPTPSHydrophilic
NLS Segment(s)
PositionSequence
24-47PRAPRIARRRRARRRVVSPKVKPT
Subcellular Location(s) nucl 20.5, cyto_nucl 14.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences RNSYQCPAPYPTPTPLRTRTTLPPRAPRIARRRRARRRVVSPKVKPTPSARTTSRASRTISAVPATRKSTSPPTHPSAIENDPYGQEPDVEFGSRTGQPDTPYYQREENKGKKEKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.51
3 0.53
4 0.5
5 0.5
6 0.53
7 0.56
8 0.62
9 0.62
10 0.65
11 0.65
12 0.71
13 0.71
14 0.71
15 0.72
16 0.73
17 0.76
18 0.77
19 0.82
20 0.85
21 0.9
22 0.91
23 0.9
24 0.9
25 0.92
26 0.91
27 0.91
28 0.87
29 0.87
30 0.84
31 0.75
32 0.67
33 0.62
34 0.61
35 0.53
36 0.51
37 0.43
38 0.41
39 0.42
40 0.46
41 0.45
42 0.39
43 0.38
44 0.33
45 0.34
46 0.31
47 0.29
48 0.23
49 0.21
50 0.2
51 0.22
52 0.23
53 0.22
54 0.21
55 0.23
56 0.3
57 0.31
58 0.35
59 0.37
60 0.39
61 0.41
62 0.41
63 0.39
64 0.35
65 0.35
66 0.3
67 0.25
68 0.22
69 0.19
70 0.2
71 0.2
72 0.15
73 0.12
74 0.11
75 0.11
76 0.12
77 0.12
78 0.11
79 0.1
80 0.14
81 0.15
82 0.16
83 0.17
84 0.18
85 0.2
86 0.23
87 0.28
88 0.31
89 0.32
90 0.34
91 0.4
92 0.42
93 0.48
94 0.55
95 0.59
96 0.63