Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165K0H4

Protein Details
Accession A0A165K0H4    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
8-35PTPVSSPSKAKTPRKKKVDPELERRMTMHydrophilic
NLS Segment(s)
PositionSequence
17-24AKTPRKKK
Subcellular Location(s) mito_nucl 13.833, nucl 13.5, mito 12, cyto_nucl 8.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR006640  SprT-like_domain  
Gene Ontology GO:0051716  P:cellular response to stimulus  
Pfam View protein in Pfam  
PF10263  SprT-like  
Amino Acid Sequences MPSPSPTPTPVSSPSKAKTPRKKKVDPELERRMTMANSLFAELNRTVFGDRITGVEIKWNPRFLTTAGRAKWKKSREGVHSSILELSPKVIDSDERLRNTVGHEMCHLASWMIDCDPAEQHGQLWNAWTKKVMRARPDIKITARHEYEISYKFRWKCTQCDNTYVPPVLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.5
3 0.58
4 0.63
5 0.67
6 0.71
7 0.77
8 0.8
9 0.87
10 0.88
11 0.89
12 0.9
13 0.88
14 0.86
15 0.87
16 0.81
17 0.72
18 0.63
19 0.54
20 0.43
21 0.37
22 0.28
23 0.2
24 0.17
25 0.18
26 0.17
27 0.15
28 0.19
29 0.16
30 0.15
31 0.12
32 0.12
33 0.11
34 0.11
35 0.11
36 0.09
37 0.09
38 0.09
39 0.1
40 0.1
41 0.1
42 0.15
43 0.17
44 0.22
45 0.24
46 0.26
47 0.24
48 0.24
49 0.26
50 0.21
51 0.27
52 0.27
53 0.31
54 0.31
55 0.4
56 0.4
57 0.43
58 0.49
59 0.45
60 0.46
61 0.45
62 0.51
63 0.49
64 0.55
65 0.54
66 0.52
67 0.48
68 0.41
69 0.36
70 0.29
71 0.22
72 0.14
73 0.11
74 0.06
75 0.06
76 0.06
77 0.05
78 0.05
79 0.09
80 0.17
81 0.22
82 0.23
83 0.24
84 0.24
85 0.24
86 0.25
87 0.29
88 0.21
89 0.17
90 0.17
91 0.17
92 0.17
93 0.17
94 0.15
95 0.08
96 0.08
97 0.08
98 0.08
99 0.06
100 0.07
101 0.06
102 0.07
103 0.08
104 0.09
105 0.1
106 0.09
107 0.1
108 0.14
109 0.15
110 0.13
111 0.16
112 0.2
113 0.2
114 0.2
115 0.23
116 0.2
117 0.27
118 0.35
119 0.38
120 0.39
121 0.49
122 0.53
123 0.58
124 0.62
125 0.6
126 0.56
127 0.59
128 0.57
129 0.56
130 0.52
131 0.46
132 0.41
133 0.38
134 0.41
135 0.38
136 0.38
137 0.33
138 0.39
139 0.4
140 0.46
141 0.53
142 0.51
143 0.54
144 0.59
145 0.66
146 0.62
147 0.67
148 0.66
149 0.63
150 0.65